Настройки

Укажите год
-

Небесная энциклопедия

Космические корабли и станции, автоматические КА и методы их проектирования, бортовые комплексы управления, системы и средства жизнеобеспечения, особенности технологии производства ракетно-космических систем

Подробнее
-

Мониторинг СМИ

Мониторинг СМИ и социальных сетей. Сканирование интернета, новостных сайтов, специализированных контентных площадок на базе мессенджеров. Гибкие настройки фильтров и первоначальных источников.

Подробнее

Форма поиска

Поддерживает ввод нескольких поисковых фраз (по одной на строку). При поиске обеспечивает поддержку морфологии русского и английского языка
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Ведите корректный номера.
Укажите год
Укажите год
Применить Всего найдено 1578. Отображено 100.
15-03-2012 дата публикации

ELECTRONIC DEVICE AND METHOD FOR SAVING ENERGY THEREOF

Номер: US20120066532A1
Автор: LI Jun-Jie, LIU XUE-SHUN, Lu Xin, LUO BI-QING, PENG LI-XIA, WANG DAN, WANG FEI, WONG SHIH-FANG, ZHANG HUAN-HUAN, ZHONG BIAO-GENG
Принадлежит:

An electronic device includes a dynamic memory, a static memory, a detection unit, a copy unit and a set unit. The dynamic memory stores an interrupt monitoring program. The interrupt monitoring program monitors whether an interrupt request is generated, and generates an interrupt signal when the interrupt request is generated. The detection unit detects whether the electronic device needs to enter a sleep mode, and generates a detection signal if the electronic device needs to enter the sleep mode. The copy unit copies the interrupt monitoring program from the dynamic memory to the static memory in response to the detection signal, and runs the interrupt monitoring program in the static memory for monitoring whether an interrupt signal is generated. The set unit sets the dynamic memory into a self-refresh mode in response to the detection signal. 1. An electronic device , comprising a normal mode and a sleep mode , and being capable of switching between the normal mode and the sleep mode , the electronic device further comprising:a dynamic memory comprising an auto-refresh mode and a self-refresh mode, and being capable of switching between the auto-refresh mode and the self-refresh mode; energy consumed by the dynamic memory in the auto-refresh mode being greater than that in the self-refresh mode; the dynamic memory being adapted to store an interrupt monitoring program which is used for monitoring whether an interrupt request is generated, and generating an interrupt signal when the interrupt request is generated;a central processing unit integrating a static memory thereinto;a detection unit adapted to detect whether the electronic device is needed to enter the sleep mode; and generating a detection signal when it is determined that the electronic device is needed to enter the sleep mode;a copy unit adapted to copy the interrupt monitoring program from the dynamic memory to the static memory in response to the detection signal, and run the interrupt monitoring ...

Подробнее
Номер записи: 1
31-05-2012 дата публикации

DEVICE HOUSING AND METHOD FOR MAKING THE SAME

Номер: US20120132660A1
Автор: CHANG HSIN-PEI, CHEN CHENG-SHI, CHEN WEN-RONG, CHIANG HUANN-WU, PENG LI-QUAN
Принадлежит:

A device housing is provided. The device housing includes a substrate, and an anti-fingerprint film formed on the substrate. The substrate has roughness in a range from about 0.05 μm to about 0.25 μm. The anti-fingerprint film is a nano-composite coating consisting essentially of polytetrafluoroethylene. A method for making the device housing is also described. 1. A device housing , comprising:a substrate having roughness in a range from about 0.05 μm to about 0.25 μm; andan anti-fingerprint film formed on the substrate, the anti-fingerprint film comprising a nano-composite coating consisting essentially of polytetrafluoroethylene.2. The device housing as claimed in claim 1 , wherein the anti-fingerprint film has a thickness under 2000 nm.3. The device housing as claimed in claim 2 , wherein the anti-fingerprint film has a thickness of about 100-500 nm.4. The device housing as claimed in claim 1 , wherein the substrate is made of metal or non-metal material.5. The device housing as claimed in claim 1 , wherein the anti-fingerprint film is formed on the substrate by ion plating.6. A method for making a device housing claim 1 , comprising:providing a substrate;roughening treatment the substrate to have roughness in a range from about 0.05 μm to about 0.25 μm; andforming an anti-fingerprint film on the substrate by ion plating, the anti-fingerprint film comprising nano-composite coating consisting essentially of polytetrafluoroethylene.7. The method as claimed in claim 6 , wherein ion plating the anti-fingerprint film uses a target made of polytetrafluoroethylene; uses argon as a working gas claim 6 , the argon has a flow rate of about 30-60 sccm claim 6 , ion plating the anti-fingerprint film may take for about 30-60 minutes.8. The method as claimed in claim 7 , wherein the substrate is biased with a negative bias voltage of about −100V to about −300V during vacuum sputtering the anti-fingerprint film.9. The method as claimed in claim 7 , further comprising a step of ...

Подробнее
Номер записи: 2
31-05-2012 дата публикации

Organic compounds

Номер: US20120136013A1
Автор: Hailin Zheng, Jun Zhao, Lawrence P. Wennogle, Peng Li
Принадлежит: Intra Cellular Therapies Inc

Optionally substituted (5- or 7-amino)-3,4-dihydro-(optionally 4-oxo, 4-thioxo or 4-imino)-1H-pyrrolo[3,4-d]pyrimidin-2(6H)-ones, Compounds of Formula I, processes for their production, their use as pharmaceuticals and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 3
28-06-2012 дата публикации

ARTICLE HAVING HARD FILM AND METHOD FOR MAKING THE ARTICLE

Номер: US20120164418A1
Автор: CHANG HSIN-PEI, CHEN CHENG-SHI, CHEN WEN-RONG, CHIANG HUANN-WU, PENG LI-QUAN
Принадлежит:

An article includes a substrate and a hard film formed on the substrate. The hard film includes a plurality of TiAlN layers and a plurality of BN layers, each BN layer and each TiAlN layer is alternately arranged. The disclosure also describes a method to make the article. 1. An article , comprising:a substrate; anda hard film formed on the substrate;wherein the hard film includes a plurality of alternating TiAlN layers and BN layers.2. The article as claimed in claim 1 , wherein each TiAlN layer and each BN layer has a uniform thickness ranging from 3 nm-15 nm.3. The article as claimed in claim 1 , wherein the hard film has a total thickness ranging from 1 μm-2.5 μm.4. The article as claimed in claim 1 , wherein the ceramic layer has a thickness ranging from 0.18 mm-0.4 mm.5. The article as claimed in claim 1 , wherein a BN layer is directly directly formed on a surface of the substrate.6. The article as claimed in claim 1 , wherein a TiAlN layer is the outermost layer of the article.7. The article as claimed in claim 1 , wherein the substrate is chosen from a metal alloy claim 1 , stainless steel claim 1 , and ceramic.8. A method for making an article having a hard film claim 1 , comprising:providing a substrate;providing a vacuum sputtering coating machine including a sputtering coating chamber having rotating bracket, TiAlN targets and BN targets set therein, the vacuum sputtering coating machine being used to depositing the hard film;alternately depositing TiAlN layers and BN layers on the substrate by vacuum sputtering to form the hard film on the substrate;further modifying the hard film via nitridation process.9. The method of claim 8 , wherein during alternately depositing the TiAlN layers and the BN layers claim 8 , the vacuum level inside the sputtering coating chamber is set to about 3.0×10Pa claim 8 , argon is fed into the sputtering coating chamber at a flux about 300 sccm claim 8 , nitrogen is fed into the sputtering coating chamber at a flux between ...

Подробнее
Номер записи: 4
28-06-2012 дата публикации

ARTICLE HAVING HARD FILM AND METHOD FOR MAKING THE ARTICLE

Номер: US20120164436A1
Автор: CHANG HSIN-PEI, CHEN CHENG-SHI, CHEN WEN-RONG, CHIANG HUANN-WU, PENG LI-QUAN
Принадлежит:

An article includes a substrate and a hard film formed on the substrate; the hard film includes a plurality of complex layers and a plurality of Ni layers, each complex layer and Ni layer alternately arranged; each complex layer includes a plurality of TiAlN layers and a plurality of CrAlN layers, each TiAlN layer alternately arranged with each CrAlN layer. The disclosure also described a method to make the article. 1. An article , comprising:a substrate; anda hard film formed on the substrate;wherein the hard film includes a plurality of alternating complex layers and Ni layers, each complex layer and Ni layer alternately arranged; each complex layer includes a plurality of alternating TiAlN layers and CrAlN layers, each TiAlN layer alternately arranged with each CrAlN layer.2. The article as claimed in claim 1 , wherein each complex layer includes an equal number of TiAlN layers and CrAlN layers.3. The article as claimed in claim 2 , wherein the equal number of TiAlN layers and CrAlN layers is about 5-8 of each claim 2 , having a total thickness in a range from 8 nm-20 nm.4. The article as claimed in claim 1 , wherein the hard film has a thickness in a range from 1.5 μm-3 μm.5. The article as claimed in claim 1 , wherein a complex layer is directly formed on the substrate.6. The article as claimed in claim 1 , wherein a complex layer is the outermost layer of the article.7. The article as claimed in claim 1 , wherein the substrate is chosen from a metal alloy claim 1 , stainless steel claim 1 , and ceramic.8. A method for making an article having a hard film claim 1 , comprising:providing a substrate;providing a vacuum sputtering coating machine including a sputtering coating chamber having rotating bracket, TiAlN targets, CrAlN targets, and Ni targets set therein, the vacuum sputtering coating machine used to depositing the hard film;alternately depositing TiAlN layers and CrAlN layers on the substrate to form a complex layer on the substrate;depositing a Ni ...

Подробнее
Номер записи: 5
28-06-2012 дата публикации

COATED ARTICLE AND METHOD FOR MAKING SAME

Номер: US20120164477A1
Автор: CHANG HSIN-PEI, CHEN CHENG-SHI, CHEN WEN-RONG, CHIANG HUANN-WU, PENG LI-QUAN
Принадлежит:

A coated article is provided. The coated article includes a substrate having a bonding layer, and a hard coating formed thereon, and in that order. The hard coating has a composition represented by the formula TiAlMN, in which the “x”, “y”, and “z” respectively represent the atomic percentage of Ti, Al, and M. The “M” is Sc or Dy. The “x”, “y” and “z” satisfy the following relationships: x+y+z=1, 35%≦x≦45%, and 0.01%≦z≦1%. A method for making the coated article is also described there. 1. A coated article , comprising:a substrate;a bonding layer formed on the substrate; and{'sub': x', 'y', 'z, 'a hard coating formed on the bonding layer, the hard coating having a composition represented by the formula TiAlMN, in which the “x”, “y”, and “z” respectively represent the atomic percentage of Ti, Al, and M, the “M” being Sc or Dy, the “x”, “y” and “z” satisfy the following relationships: x+y+z=1, 35%≦x≦45%, and 0.01%≦z≦1%.'}2. The coated article as claimed in claim 1 , wherein the bonding layer has a composition of TiAlM claim 1 , in which the “X” claim 1 , “Y” claim 1 , and “Z” respectively represent the atomic percentage of Ti claim 1 , Al claim 1 , and M claim 1 , the “M” being Sc or Dy claim 1 , the “X” claim 1 , “Y” and “Z” satisfy the following relationships: X+Y+Z=1 claim 1 , 35%≦X≦45% claim 1 , and 0.01%≦Z≦1%.3. The coated article as claimed in claim 1 , wherein the bonding layer has a thickness of about 20 nm-50 nm.4. The coated article as claimed in claim 1 , wherein the hard coating has a thickness of about 1.5 μm-3 μm.5. The coated article as claimed in claim 1 , wherein the bonding layer and the hard coating both are formed by magnetron sputtering.6. The coated article as claimed in claim 1 , wherein the substrate is made of material selected from the group consisting of high speed steel claim 1 , hard alloy claim 1 , cermet claim 1 , ceramic claim 1 , stainless steel claim 1 , magnesium alloy claim 1 , and aluminum alloy.7. A method for making a coated ...

Подробнее
Номер записи: 6
13-09-2012 дата публикации

Polypeptides that bind tissue inhibitor of metalloproteinase type three (timp-3), compositions and methods

Номер: US20120231013A1
Автор: Chadwick T. King, Joshua Silverman, Peng Li, Roy A. Black
Принадлежит: AMGEN INC

The present invention relates to TIMP-3 binding compositions, methods of producing such compositions, and methods of using such compositions, including in the treatment of various conditions.

Подробнее
Номер записи: 7
27-12-2012 дата публикации

Inhibitors of hepatitis c virus ns5b polymerase

Номер: US20120328569A1
Автор: Casey Cameron Mccomas, Frank Narjes, Hao Wu, Joerg Habermann, Nigel J. Liverton, Peng Li, Richard Soll, Shilan Liu, Uwe Koch, Xuanjia Peng
Принадлежит: Individual

Disclosed are compounds of formula (I) that are used as hepatitis C virus (HCV) NS5B polymerase inhibitors, the synthesis of such compounds, and the use of such compounds for inhibiting HCV NS5B polymerase activity, for treating or preventing HCV infections and for inhibiting HCV viral replication and/or viral production in a cell-based system.

Подробнее
Номер записи: 8
21-02-2013 дата публикации

SANDBLASTING APPARATUS

Номер: US20130045664A1
Автор: CHANG HSIN-PEI, HUANG TENG-TSUNG, PENG LI-QUAN
Принадлежит:

A sandblasting apparatus comprises a sand tube for the input of sand particles, a fluid tube for the input of a fluid substance, the fluid tube and the sand tube cooperatively defining an acute angle; a mixing chamber communicating with the sand tube and the fluid tube, a major output tube communicating with the mixing chamber; and an auxiliary output tube including a first part and a second part. The first part communicates with the mixing chamber and the second part. The second part extends towards the major output tube, offset from the axial direction of the first part. The axis of the second part and the axis of the major output tube cooperatively define an acute angle. 1. A sandblasting apparatus , comprising:a sand tube for inputting sand particles;a fluid tube for inputting fluid substance, the fluid tube and the sand tube cooperatively defining an acute angle β;a mixing chamber connecting and communicating with the sand tube and the fluid tube, the mixing chamber providing a room mixing the sand particles and the fluid substance therein;a major output tube connecting and communicating with the mixing chamber; andan auxiliary output tube including a first part and a second part, one end of the first part connecting and communicating with the mixing chamber, another end of the first part connecting and communicating with the second part, the second part offsetting from the axial direction of the first part and extending towards the major output tube, the axis of the second part and the axis of the major output tube cooperatively defining an acute angle θ.2. The sandblasting apparatus as claimed in claim 1 , wherein the major output tube is substantially coaxial with the mixing chamber and the fluid tube.3. The sandblasting apparatus as claimed in claim 2 , wherein the acute angle θ is about 30 degrees to about 60 degrees.4. The sandblasting apparatus as claimed in claim 3 , wherein the acute angle θ is 45 degrees.5. The sandblasting apparatus as claimed in ...

Подробнее
Номер записи: 9
28-02-2013 дата публикации

SLIDER, HEAD GIMBAL ASSEMBLY AND DISK DRIVE UNIT WITH THE SAME

Номер: US20130050877A1
Автор: CHOU Shen kuang Sidney, PENG Li ping, WANG Yan bin, XIAO Lu, YUEN Chi hung
Принадлежит: SAE Magnetics (H.K.) Ltd.

A slider includes a substrate having a trailing edge, a leading edge opposite the trailing edge, and an air bearing surface connecting the trailing edge with the leading edge; a read/write transducer formed at the trailing edge; and a coat layer attached on the trailing edge and covering on the read/write transducer. The slider further includes a protection layer for shielding the read/write transducer thereby preventing the read/write transducer from damaging during a laser soldering process. The present invention can prevent the read/write transducer from damaging during the laser bonding process and, in turn improve the reading and writing performance of the slider. The invention also discloses an HGA and a disk drive unit. 1. A slider comprising:a substrate having a trailing edge, a leading edge opposite the trailing edge, and an air bearing surface connecting the trailing edge with the leading edge;a read/write transducer formed at the trailing edge; anda coat layer attached on the trailing edge and covering on the read/write transducer;wherein the slider further comprises a protection layer for shielding the read/write transducer thereby preventing the read/write transducer from damaging during a laser soldering process.2. The slider according to claim 1 , wherein the coat layer has a trailing surface opposite to the leading edge claim 1 , and the protection layer is formed on the trailing surface.3. The slider according to claim 1 , wherein the protection layer is embedded in the coat layer.4. The slider according to claim 1 , wherein the read/write transducer has a surface opposite to the leading edge claim 1 , and the protection layer is formed on the surface directly.5. The slider according to claim 1 , wherein the protection layer has a reflectivity that is capable of reflecting a laser.6. A head gimbal assembly comprising:a slider; anda suspension for supporting the slider;wherein the slider comprises:a substrate having a trailing edge, a leading edge ...

Подробнее
Номер записи: 10
07-03-2013 дата публикации

MEDIUM FREQUENCY MAGNETRON SPUTTERING DEVICE

Номер: US20130056352A1
Автор: CHANG HSIN-PEI, HUANG TENG-TSUNG, PENG LI-QUAN
Принадлежит:

A medium frequency magnetron sputtering device comprises a vacuum chamber, a rotary rack located in the center of the vacuum chamber, a pair of targets located between the inner wall of the vacuum chamber and the rotary rack, an inner partition, and at least one outer partition. The inner partition is located between the inner wall of the vacuum chamber and the pair of targets, the at least one outer partition is moveable and prevents the deposition of any sputtered target atoms on the rotary rack during the cleaning target process. 2. The medium frequency magnetron sputtering device as claimed in claim 1 , wherein the targets are cylindrical.3. The medium frequency magnetron sputtering device as claimed in claim 2 , wherein the at least one outer partition comprises two outer partitions claim 2 , each outer partition locates around a target and is capable of moving around the target.4. The medium frequency magnetron sputtering device as claimed in claim 3 , wherein each outer partition includes an arc-shaped main body and a plate-shaped connection extending from one end of the main body.5. The medium frequency magnetron sputtering device as claimed in claim 4 , wherein the cross-section of the main body is semi-circular claim 4 , the cross-sections of the main body and the targets are coaxial.6. The medium frequency magnetron sputtering device as claimed in claim 4 , wherein the two connection interact to form a single wall when the two outer partitions moves to a position between the targets and the rotary rack.7. The medium frequency magnetron sputtering device as claimed in claim 6 , wherein the length of the inner partition is equal or greater than the length of the two outer partitions connecting together.8. The medium frequency magnetron sputtering device as claimed in claim 1 , wherein the at least one outer partition comprises an outer partition claim 1 , the outer partition comprises a plate-shaped main partition and two arc-shaped side partition extending ...

Подробнее
Номер записи: 11
04-04-2013 дата публикации

Organic compounds

Номер: US20130085123A1
Автор: Hailin Zheng, Jun Zhao, Lawrence P. Wennogle, Peng Li
Принадлежит: Intra Cellular Therapies Inc

Optionally substituted 4,5,7,8-tetrahydro-(optionally 4-oxo, 4-thioxo or 4-imino)-(1H or 2H)-imidazo[1,2-a]pyrazolo[4,3-e]pyrimidine or 4,5,7,8,9-pentahydro-(optionally 4-oxo, 4-thioxo or 4-imino)-(1H or 2H)-pyrimido[1,2-a]pyrazolo[4,3-e]pyrimidine compounds, processes for their production, their use as pharmaceuticals and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 12
23-05-2013 дата публикации

IONIZATION DEVICE AND EVAPORATION DEPOSITION DEVICE USING THE IONIZATION DEVICE

Номер: US20130126342A1
Автор: HUANG TENG-TSUNG, PENG LI-QUAN
Принадлежит:

An ionization device used in an evaporation deposition device includes a main body, and an electron-beam system, a magnetic field generator all mounted to the main body. The main body includes a peripheral wall and a cavity enclosing by the peripheral wall. The electron-beam system includes an electric filament. The electric filament connects with a first power source. The electric filament and the main body connect with a direct current power source. The magnetic field generator includes a coil and a second power source connecting with the coil. An evaporation deposition device using the ionization device is also described. 1. An ionization device used in an evaporation deposition device , comprising:a main body comprising a peripheral wall and a cavity enclosed by the peripheral wall;an electron-beam system mounted to the main body, the electron-beam system comprising an electric filament connecting with a first power source, the electric filament and the main body connecting with a direct current power source; anda magnetic field generator mounted to the main body, the magnetic field generator comprising a coil and a second power source connecting with the coil.2. The ionization device as claimed in claim 1 , wherein the main body is a cylindrical structure having an open end and a lower open end.3. The ionization device as claimed in claim 1 , wherein the peripheral wall has a thickness of about 1 cm to 5 cm.4. The ionization device as claimed in claim 1 , wherein the peripheral wall has a thickness of about 3 cm.5. The ionization device as claimed in claim 1 , wherein the main body is made of aluminum claim 1 , stainless steel claim 1 , or copper.6. The ionization device as claimed in claim 1 , wherein the electric filament is disposed inside in the cavity and parallels to the peripheral wall claim 1 , when the first power source is turned on claim 1 , the electric filament is electrified to generate heat and emit hot electrons in the cavity.7. The ionization ...

Подробнее
Номер записи: 13
13-06-2013 дата публикации

JIG ASSEMBLY FOR ORIENTING, SORTING AND SELECTING FASTENER NUTS

Номер: US20130146511A1
Автор: Huang Jian-Ming, PENG LI-DONG, YANG KAI-LAI, Zhang Yang, Zhao Yu
Принадлежит: HON HAI PRECISION INDUSTRY CO., LTD.

A jig assembly for selecting and presenting fastener nuts in the correct orientation, each fastener nut including a nut cap and an assembling portion formed on an end of the fastener nut. The diameter of the nut cap is larger than the diameter of the assembling portion. The jig assembly includes an electric cabinet, a jig bracket, a feed container, and a sorting tray. The feed container includes a selector with an opening. The width of the opening is equal to the height of the fastener nut, the first sidewall of the selector forms a plurality of restricting protrusions, and each two adjacent restricting protrusions cooperatively define a restricting groove therebetween. The width of each restricting groove is equal to the diameter of the assembling portion, thus only fastener nuts in the correct orientation are capable of passing through the selector to be collected in the sorting tray. 1. A jig assembly for selecting , orienting and sorting a plurality of fastener nuts in a correct orientation of the fastener nuts , each fastener nut comprising a nut cap and an assembling portion formed on an end of the nut cap , the jig assembly comprising:an electric cabinet;a jig bracket loaded on a top of the electric cabinet;a feed container comprising a selector assembled on the jig bracket; anda sorting tray detachably assembled on the jig bracket below the feed container, wherein the diameter of the nut cap of the fastener nut is larger than the diameter of the assembling portion, the selector comprises a first sidewall and a second sidewall opposite to the first sidewall, and defines an opening between the first sidewall and the second sidewall in an end of the selector adjacent to the sorting tray, the width of the opening of the selector is equal to the height of the fastener nut, the first sidewall forms a plurality of restricting protrusions protruding out from the inner surface of the first sidewall, every two adjacent restricting protrusions cooperatively define a ...

Подробнее
Номер записи: 14
13-06-2013 дата публикации

Novel regulatory proteins and inhibitors

Номер: US20130149309A1
Автор: Gen He, Lawrence P. Wennogle, Paul Greengard, Peng Li, Wenjie Luo
Принадлежит: Intra Cellular Therapies Inc, ROCKEFELLER UNIVERSITY

The invention provides a previously uncharacterized protein (gamma secretase activating protein or gSAP) that activates γ-secretase to produce β-amyloid protein (Aβ). Deposition of Aβ has been associated with Alzheimer's disease and other pathologies. The invention thus additionally provides, e.g., screening methods and novel research tools, inhibitors of this novel protein, and methods of diagnosis, treatment and control of Alzheimer's disease and other neurodegenerative conditions associated with deposition of Aβ.

Подробнее
Номер записи: 15
27-06-2013 дата публикации

ELECTRONIC DEVICE AND TOUCH INPUT CONTROL METHOD THEREOF

Номер: US20130162603A1
Автор: LIU XUE-SHUN, Lu Xin, PENG LI-XIA, WANG FEI, ZHANG HUAN-HUAN, ZHENG ZHANG-YONG
Принадлежит:

A touch input control method comprising steps is provided: displaying an interface comprising at least one object; gathering signals as to actual touches for calibration purposes. In use, calculating coordinates of the touch; determining whether the coordinates of the actual touch match the predetermined touch coordinates of the object; creating an adjustment signal if the coordinates of the touch is not the same as the predetermined touch coordinates of any object; determining which finger used for touch input, and retrieving a touch offset direction and a touch offset distance of the determined finger of the user from a calibration database; and applying compensation to the coordinates of the touch, so as to determine the touched object. An electronic device using the touch input control method is also provided. 1. A touch input control method for an electronic device with a touch screen and a storage unit storing a calibration database , the method comprising:displaying an interface comprising a plurality of objects, each object associated with predetermined touch coordinates;generating signals in response to a touch on the touch screen which is an attempt to touch an object;calculating coordinates of the actual touched portion on the touch screen according to the generated signals;determining whether the coordinates of the touch match the predetermined touch coordinates of one of the objects displayed on the touch screen;creating an adjustment signal if the coordinates of the touch match the predetermined touch coordinates of any of the objects;determining which finger it is which does the actual touching according to the shape of the touched area, the size of the touched area, and the touch calibration data of the user's commonly used finger, recorded in the calibration database, and retrieving the touch offset direction and the touch offset distance of the determined finger of the user from the calibration database; andcompensating the coordinates of the touch ...

Подробнее
Номер записи: 16
11-07-2013 дата публикации

SEAMLESS CONNECTING SHELL AND LIGHTING DEVICE USING THE SAME

Номер: US20130176720A1
Автор: CHEN Yarn-Chen, PENG Li-Chung
Принадлежит:

The present invention provides a shell for a lighting device. The shell comprises a first lamp body, a second lamp body, a first connecting part, and a second connecting part. The ends of the second lamp body have a first end surface and a second end surface. The first connecting part lying along a first direction is set in the first end surface and threads through the first bottom surface. The second connecting part lying along a direction opposite to the first direction is set in the second end surface and threads through the second bottom surface. When the first lamp body is connected with the second lamp body, the two ends of the first lamp body are disposed extending over edges of the first end surface and the second end surface separately. 1. A shell for a lighting device , the shell comprising:a first lamp body, having a first long line and a first short line wherein the first long line lies along a first direction;a second lamp body, having a second long line wherein the second long line has a length not more than that of the first long line, the second long line lies along the first direction, and two ends of the second lamp body have a first end surface and a second end surface, separately;a first connecting part, set in the first end surface and extruding through the first end surface along the first direction; anda second connecting part, set in the second end surface and extruding through the second end surface along a direction opposite to the first direction;wherein the first lamp body and the second lamp body are connected together, the second lamp body are drawn back inside the first lamp body, the two ends of the first lamp body are disposed extending over edges of the first end surface and the second end surface separately, and the sum of lengths of the first connecting part, the second connecting part and the second long line is not larger than that of the first long line.2. The shell according to claim 1 , wherein the geometrical center of ...

Подробнее
Номер записи: 17
14-11-2013 дата публикации

HOLDER OF A PORTABLE ELECTRIC DEVICE

Номер: US20130299231A1
Автор: LEE Chien Liang, XU Peng Li
Принадлежит:

A holder of a portable electric device includes a main body formed integrally. The main body has an intermediate portion formed with a recessed wire-collecting portion, having one end provided with a holding portion having an outer wall disposed with a crevice and a wire-positioning hole bored under the crevice, and another end formed with a clamping portion having an outer wall cut with a clamping opening, a crevice, and a wire-positioning hole bored inside the crevice. Thus, the clamping opening can clamp the portable electric device and the holding portion can be fixed on a table top to have the portable electric device positioned obliquely at an appropriate angle for facilitating browsing and operating. Further, the wires of the portable electric device or of its peripheral products can be positioned in the wire-collecting holes and orderly wound on the wire-collecting portion. 1. A holder of a portable electric device comprising a bar-shaped main body formed integrally , said main body having an intermediate portion formed with a recessed wire-collecting section , said main body having one end provided with a holding portion , said holding portion having an outer wall cut with a crevice , a wire-positioning hole bored under said crevice , said main body having another end provided with a clamping portion , said clamping portion having an outer wall cut with a clamping opening , a crevice , and a wire-positioning hole. bored inside said crevice2. The holder of a portable electric device as claimed in claim 1 , wherein said main body is made of soft gelatinous substance.3. The holder of a portable electric device as claimed in claim 1 , wherein said holding portion of said main body has an outer edge provided with a hanging hole. 1. Field of the InventionThis invention relates to a holder of a portable electric device, particularly to one formed integral with a bar-shaped main body having an intermediate portion formed with a recessed wire-collecting section. The ...

Подробнее
Номер записи: 18
28-11-2013 дата публикации

Fault current limiter

Номер: US20130314828A1
Автор: Bradley Lehman, Gianfranco de Palma, Peng Li, SONG Chen
Принадлежит: Mersen USA Newburyport MA LLC, Northeastern University Boston

A fault current limiter (FCL) for limiting a fault current in a power line during a fault condition. The FCL includes a magnetic coupling circuit for monitoring current in the power line through magnetic coupling; a sensing circuit for sensing the current in the power line and providing a signal indicative of the sensed current; a control circuit receiving the signal indicative of the sensed current in the power line and determining whether the sensed current indicates that the fault condition exists; and high and low impedance paths that are connected in parallel. The high impedance path includes a discharging impedance circuit for limiting the fault current. The low impedance path includes a reactor circuit and a switching unit having an ON state for conducting current through the low impedance path and an OFF state for conducting current through the high impedance path.

Подробнее
Номер записи: 19
23-01-2014 дата публикации

Lathe for machining curved surfaces

Номер: US20140020523A1
Автор: Bao-Peng Li, Feng-hua CHEN, Jian Qu, Jian-hua JIA, Jian-min YU, Jian-Shi Jia, Jing-Shuang Sui, Ming-lu YANG, Tian-en ZHANG, Wei-chuan ZHANG, XUE Qin, Ya-dong ZHANG, Yang-Mao Peng, Zhen-Zhou Tian
Принадлежит: Individual

A lathe includes a machine support, a working table positioned on the machine support, a rotating driver, a moving device, and a feeding device. The rotating driver rotates the work table. The moving device includes at least one cross beam, at least one first driving mechanism, and at least one second driving mechanism. The cross beam is movably positioned on the machine support above the working table. The feeding device is movably positioned on the at least one cross beam, and includes a feeding driving mechanism and a cutter. The first driving mechanism drives the cross beam to move along a first direction, and the second driving mechanism drives the feeding device to move along a second direction at about ninety degrees from the first direction. The feeding mechanism drives the cutter to move backwards and forwards along a third direction perpendicular to the first and second direction.

Подробнее
Номер записи: 20
23-01-2014 дата публикации

Machine tool with uninterrupted cutting

Номер: US20140020527A1
Автор: Bao-Peng Li, Feng-hua CHEN, Jian Qu, Jian-hua JIA, Jian-min YU, Jian-Shi Jia, Jing-Shuang Sui, Ming-lu YANG, Tian-en ZHANG, Wei-chuan ZHANG, XUE Qin, Ya-dong ZHANG, Yang-Mao Peng, Zhen-Zhou Tian
Принадлежит: Individual

A machine tool includes a machine support, a work table positioned on the machine support, a moving device and a feeding device. The moving device is movably mounted on the machine support along a first direction above the work table. The feeding device is slidably positioned on the moving device along a second direction at ninety degrees from the first direction. The feeding device includes a feeding mechanism and a cutter. The feeding mechanism drives the tool holder and the cutter to move back and forth along a third orthogonal direction.

Подробнее
Номер записи: 21
13-03-2014 дата публикации

ANTIBODIES THAT SPECIFICALLY BIND STAPHYLOCOCCUS AUREUS ALPHA TOXIN AND METHODS OF USE

Номер: US20140072577A1
Автор: Chowdhury Partha, Damschroder Melissa, Hilliard Jamese Johnson, Hua Lei, Oganesyan Vaheh, Peng Li, SELLMAN Bret, TKACZYK Christine, Varkey Reena
Принадлежит: MEDIMMUNE, LLC

Herein provided are compositions, methods of manufacture and methods of use pertaining to anti-alpha toxin antibodies and fragments. 184-. (canceled)85Staphylococcus aureus. An isolated antibody or antigen-binding fragment thereof , wherein the isolated antibody or antigen-binding fragment thereof immunospecifically binds to a alpha toxin polypeptide and comprises:(a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 7, 10, 13 or 69;(b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 8, 11, 14, 17, 70 or 75;(c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 or 78;(d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or 4;(e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 2, 5, 73 or 77; and(f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 6, 64, 68 or 74.86. The antibody or antigen binding fragment of claim 85 , wherein the VH CDR1 claim 85 , VH CDR2 claim 85 , VH CDR3 claim 85 , VL CDR1 claim 85 , VL CDR2 and VL CDR3 correspond to the amino acid sequences of SEQ ID NOs: 7 claim 85 , 8 claim 85 , 9 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 10 claim 85 , 11 claim 85 , 12 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 13 claim 85 , 14 claim 85 , 15 claim 85 , 4 claim 85 , 5 and 6; SEQ ID NOs: 7 claim 85 , 17 claim 85 , 18 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 16 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 65 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs; 7 claim 85 , 8 claim 85 , 66 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 67 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 67 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 78 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 65 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: 69 claim 85 , 70 claim 85 , 71 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: ...

Подробнее
Номер записи: 22
04-01-2018 дата публикации

Biomarkers useful in liver fibrosis diagnosis

Номер: US20180003722A1
Автор: Angelina Huai-Lo Lee, Hong-Zen Yeh, Hung-Yi Li, Ping-Fu Cheng, Tzu-Ling Tseng, Wei-Ya Lin, Yen-Peng Li, Yi-Chen Liu
Принадлежит: Industrial Technology Research Institute ITRI

Identification of urokinase-type plasminogen, matrix metalloproteinase 9, and β-2-microglobulin as novel biomarkers associated with liver fibrosis and uses thereof in diagnosing and staging liver fibrosis.

Подробнее
Номер записи: 23
07-01-2021 дата публикации

Internet of things system with prediction of farmland soil status and method for creating model thereof

Номер: US20210004694A1
Автор: Chi-Yao Ku, Chin-Cheng Wang, Chun-Yu Chu, Erick Wang, Fung Ling Ng, Jiun-Yi Lin, Jui-Yu Ho, Li-Chi PENG, Lung-Chieh Chen, Meng-Zhan Lee, Nian-Ruei Deng, Shao-Yu Chiu, Szu-Chia Chen, Tai-Hsiang Yen, Tzu-I Hsieh, Wei-Han Chen, Wen-Liang Chen, Yen-Ling Chen, Yi-Bing Lin, Yu-Chi Shih, Yu-Ci Chang, Yuan-Yao Chan, Yun-Wei Lin
Принадлежит: National Chiao Tung University NCTU

An IoT system includes a computing module for controlling an integral function of the system and including an analysis unit and a machine learning unit. The analysis unit is capable of operational analysis and creating a predictive model and creating a predictive model according to the data analyzed. The machine learning unit has an algorithm function to create a corresponding learning model. An IoT module is electrically connected to the computing module to serve as an intermediate role. At least one detection unit is electrically connected to the IoT module and disposed in soil to detect data of environmental and soil conditions and sends the data detected to the computing module for subsequent analysis.

Подробнее
Номер записи: 24
17-01-2019 дата публикации

GARLIC COMPOSITIONS

Номер: US20190015470A1
Автор: BEAH Zhi Ming, DE COSTA Patricia, LAU Kian Giap, PENG Li Vern
Принадлежит: INQPHARM GROUP SDN BHD

The present invention relates generally to compositions comprising at least two different garlic extracts, and to the use of said compositions for improving blood flow and/or reducing platelet aggregation and/or maintaining and/or improving the overall health of the circulatory system in a subject. For example, the compositions may also be used to treat or reduce or prevent the onset of one or more of cardiovascular diseases, cerebrovascular or brain diseases, immune diseases, bone, joint and muscle diseases fatigue and cell oxidation. The compositions may also be used to increase energy, improve nutrient delivery and/or metabolic waste removal, as well as to improve cell protection and repairing activities. 1. A composition comprising:a first garlic extract; anda second garlic extract different to the first garlic extract.2. A composition according to claim 1 , wherein the first and/or second garlic extract claim 1 , is derived from raw garlic claim 1 , aqueous garlic extract claim 1 , non-aqueous garlic extract claim 1 , alcoholic garlic extract claim 1 , garlic concentrate claim 1 , garlic oil claim 1 , garlic maceration claim 1 , garlic powder claim 1 , garlic granules or any combination of two or more thereof.3. A composition according to claim 1 , wherein the first garlic extract and the second garlic extract have a synergistic effect on inhibition of platelet aggregation.4. A composition according to claim 3 , wherein a % inhibition of platelet aggregation by the composition is greater than a sum of individual % inhibition of platelet aggregation by the first and second garlic extracts.5. A composition according to claim 4 , wherein the % inhibition of platelet aggregation by the composition is at least about 10% greater than the sum of the individual % inhibition of platelet aggregation by the first and second garlic extracts.6. A composition according to claim 1 , wherein a half maximal inhibitory concentration (IC) of the composition is less than an ...

Подробнее
Номер записи: 25
16-01-2020 дата публикации

ANTIMICROBIAL GARLIC COMPOSITIONS

Номер: US20200016227A1
Автор: DE COSTA Patricia, LIM King Ting, PENG Li Vern
Принадлежит: MOOTRAL SA

A composition of a first garlic extract and a second garlic extract that is different to the first garlic extract. The composition is useful as an antimicrobial, such as in pharmaceutical compositions including the first garlic extract and the second garlic extract. The invention further includes methods for making said compositions and pharmaceutical compositions. 1. (canceled)2. An antimicrobial composition comprising:a first garlic extract; anda second garlic extract different to the first garlic extract.3. A composition according to claim 2 , wherein the first and/or second garlic extract is derived from fresh garlic claim 2 , aqueous garlic extract claim 2 , non-aqueous garlic extract claim 2 , alcoholic garlic extract claim 2 , garlic concentrate claim 2 , garlic oil claim 2 , garlic maceration claim 2 , garlic powder claim 2 , garlic granules or any combination of two or more thereof.4. A composition according to claim 2 , wherein at least one of the first and the second garlic extracts is an aged garlic extract.5. A composition according to claim 4 , wherein the aged garlic extract is a black garlic extract claim 4 , caramelised garlic extract and/or fermented garlic extract.6. A composition according to claim 2 , wherein at least one of the first and the second garlic extracts is a non-aged (white) garlic extract.7. A composition according to claim 6 , wherein the non-aged garlic extract is deodourised garlic extract or deodourised garlic powder extract.8. A composition according to claim 2 , wherein the first garlic extract is a deodourised garlic extract and the second garlic extract is a black garlic extract.9. A composition according to claim 2 , wherein at least one of the first garlic extract and second garlic extract comprises at least about 3 wt % allicin.10. A composition according to claim 9 , wherein at least one of the first garlic extract and second garlic extract comprises at least about 5 wt % polyphenol.11. A composition according to claim 9 ...

Подробнее
Номер записи: 26
16-01-2020 дата публикации

Novel co-crystals

Номер: US20200017500A9
Автор: Edwin Aret, Peng Li
Принадлежит: Intra Cellular Therapies Inc

The disclosure provides new, stable, pharmaceutically acceptable co-crystal forms of 1-(4-fluoro-phenyl)-4-((6bR, 10aS)-3-methyl-2,3,6b,9, 10, 10a-hexahydro-1H,7H-pyrido[3′,4′:4,5]pyrrolo[1,2,3-de[quinoxalin-8-yl)-butan-1-one, together with methods of making and using them, and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 27
21-01-2021 дата публикации

Method, device and computer-readable storage medium for guiding symbolic execution

Номер: US20210019250A1
Автор: Minghua Wang, Peng Li, Qian Feng, Shengjian GUO, Tao Wei, Yulong Zhang
Принадлежит: Baidu Online Network Technology Beijing Co Ltd

The present disclosure provides a method, apparatus, device and computer-readable storage medium for guiding symbolic execution. According to embodiments of the present disclosure, it is possible to determine the specific code region of the program, and obtain the program loop output of the program corresponding to the specific code region of the program by using the program inverse analysis method, so that it is possible to obtain the program loop input of the program corresponding to the specific code region by using the program loop predictor according to the program loop output of the program. In this way, the obtained program loop input of the program corresponding to the specific code region may be used to guide the symbolic execution to filter out impossible execution paths and jump out of the program code and reach the specific code region, thereby improving the reliability of the symbolic execution.

Подробнее
Номер записи: 28
22-01-2015 дата публикации

COMBINATION THERAPIES USING ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES

Номер: US20150023966A1
Автор: Bezabeh Binyam, Chowdhury Partha, Damschroder Melissa, DIGIANDOMENICO Antonio, Dimasi Nazzareno, Fleming Ryan, GAO CHANGSHOU, GAO Cuihua, Guillard SAndrine, Minter Ralph, Peng Li, Rainney Godfrey, Rust Steven, SELLMAN Bret, Stover Charles, Tomich Mladen, Varkey Reena, Venkatraman Vignesh, Warrener Paul
Принадлежит:

This disclosure relates to combination therapies comprising anti-Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of infection. 173-. (canceled)74Pseudomonas. An isolated binding molecule or antigen binding fragment thereof that specifically binds to PcrV , wherein the binding molecule:{'i': 'Pseudomonas', '(a) binds to the same PcrV epitope as an antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) comprising the amino acid sequence SEQ ID NO: 216 and a light chain variable region (VL) comprising the amino acid sequence SEQ ID NO: 217;'}{'i': 'Pseudomonas', '(b) competitively inhibits PcrV binding by an antibody or antigen-binding fragment thereof comprising a VH comprising the amino acid sequence SEQ ID NO: 216 and a VL comprising the amino acid sequence SEQ ID NO: 217; or'}(c) a combination of (a) and (b).75. The binding molecule of claim 74 , comprising:(a) a heavy chain CDR1 comprising SYAMN (SEQ ID NO:218), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; a heavy chain CDR2 comprising AITISGITAYYTDSVKG (SEQ ID NO: 219), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; and a heavy chain CDR3 comprising EEFLPGTHYYYGMDV (SEQ ID NO: 220), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions;(b) a light chain CDR1 comprising RASQGIRNDLG (SEQ ID NO: 221), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; a light chain CDR2 comprising SASTLQS (SEQ ID NO: 222), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; and a light chain CDR3 comprising LQDYNYPWT (SEQ ID NO: 223), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; or(c) a combination of (a) and (b).76. The binding molecule of claim 74 , comprising:(a) a heavy chain variable region having at least 90% sequence identity to SEQ ID ...

Подробнее
Номер записи: 29
25-01-2018 дата публикации

Light emitting diode chip and preparation method thereof

Номер: US20180026164A1
Автор: Jiangbo Wang, Lingfeng Yin, Peng Li, Peng XIE, TAO Han
Принадлежит: HC Semitek Corp

A method for preparing a light emitting diode chip, the method including: 1) providing a substrate; 2) growing an n-type semiconductor layer, an active layer and a p-type semiconductor layer on the substrate sequentially in that order; 3) forming a step including an upper horizontal end surface, a lower horizontal end surface and a step surface in the n-type semiconductor layer, the active layer and the p-type semiconductor layer; 4) growing a transparent conductive layer on the upper horizontal end surface, and forming an etching hole in the middle of the transparent conductive layer; 5) forming an N electrode on the lower horizontal end surface, and forming a P electrode in the etching hole; 6) growing a metal catalyst layer on the light emitting diode chip; and 7) forming a fluorinated graphene protective layer on the metal catalyst layer.

Подробнее
Номер записи: 30
24-01-2019 дата публикации

Optimizing structures to fit into a complete cache line

Номер: US20190026088A1
Автор: Can Que, Peng Li, Wenqing Fu, Zhigang Gong, Zhiwen WU
Принадлежит: Intel Corp

An input data structure of a first size may be converted to a plurality of data structures of a second size smaller than the first size. The data structures of the second size are realigned such that each of the plurality of data structures fits in one cache line. The realigned data structures are compiled for use in a vector machine.

Подробнее
Номер записи: 31
23-01-2020 дата публикации

AUTHENTICATION WITHOUT INPUTTING PASSWORDS

Номер: US20200026827A1
Автор: Fu Jin Hong, Huang He, Li Shi Peng, Ma Shi Chong
Принадлежит:

The present disclosure provides a computer-implemented method, computer system and computer program product for user authentication. According to the method, identity information can be received from a user, and a plurality of questions can be presented to the user, the plurality of questions comprising one or more valid questions generated based on a password related to the identity information and one or more invalid questions. Then, an input can be received from the user, and in response to the input corresponding to the one or more valid questions, the user can be authenticated based on the input. 1. A computer-implemented method comprising:receiving identity information from a user;presenting a plurality of questions to the user, wherein the plurality of questions includes one or more valid questions generated based on a password related to the identity information and one or more invalid questions;receiving an input from the user; andin response to the input corresponding to the one or more valid questions, authenticating the user based on the input.2. The computer-implemented method of claim 1 , wherein the authenticating the user based on the input further comprising:in response to the input matching with at least one answer of the one or more valid questions, authenticating the user to be a valid user; andin response to the input not matching with at least one answer of the one or more valid questions, authenticating the user to be an invalid user.3. The computer-implemented method of claim 1 , further comprising:in response to the input corresponding to the one or more invalid questions, authenticating the user to be an invalid user.4. The computer-implemented method of claim 1 , wherein each of the plurality of questions is determined to be a valid question or an invalid question according to a preset authentication rule.5. The computer-implemented method of claim 4 , wherein the authentication rule further defines the number of rounds of questions to be ...

Подробнее
Номер записи: 32
04-02-2021 дата публикации

PHARMACEUTICAL COMPOSITIONS COMPRISING 4-(6Br,10aS)-3-METHYL-2, 3, 6b, 9, 10, 10a-HEXAHYDRO-1H, 7H-PYRIDO[3', 4', 5] PYROLO[1,2,3-de] QUINOXALIN-8YL)- 1- (4-FLUOROPHENYL)-BUTANE-1-ONE AND METHODS OF TREATING CONDITIONS OF THE CENTRAL NERVOUS SYSTEM

Номер: US20210032247A1
Автор: Lawrence P. Wennogle, Peng Li, Qiang Zhang, Robert Davis
Принадлежит: Intra Cellular Therapies Inc

The invention relates to pharmaceutical compositions comprising 4-((6bR,10aS)-3-methyl-2,3,6b,9,10,10a-hexahydro-1H,7H-pyrido[3′,4′:4,5]pyrrolo[1,2,3-de]quinoxalin-8-yl)-1-(4-fluorophenyl)-butan-1-one, and methods of use in the treatment of diseases involving 5-HT 2A receptor, serotonin transporter (SERT) pathway and/or the dopamine D 2 receptor pathway, and methods of treating conditions of the central nervous system therewith.

Подробнее
Номер записи: 33
11-02-2016 дата публикации

Organic compounds

Номер: US20160039835A1
Автор: Hailin Zheng, Jun Zhao, Lawrence Wennogle, Peng Li
Принадлежит: Intra Cellular Therapies Inc

Provided are PDE1 inhibitors of Formula I, processes for their production and their use as pharmaceuticals, and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 34
31-01-2019 дата публикации

Scaling ipsec processing on a virtual machine

Номер: US20190036894A1
Автор: Peng Li, Yong Wang
Принадлежит: Nicira Inc

Certain embodiments described herein are generally directed to performing receive side scaling at a virtual network interface card for encapsulated encrypted data packets based on an security parameter index value of the encapsulated encrypted data packets.

Подробнее
Номер записи: 35
07-02-2019 дата публикации

Non-legged reusable air-launched carrier rocket

Номер: US20190039753A1
Автор: Peng Li
Принадлежит: Individual

Disclosed is a non-legged reusable air-launched carrier rocket mounted on a mid-line pylon of a supersonic fighter or a bomber fuselage and its length is not limited by the front undercarriage of the carrier aircraft. The rocket body has opposite upper and lower elongated openings at the position of the front undercarriage of the carrier aircraft. When running, the upper cover and lower cover of the openings open to the rocket body to form a vertical passage, so that the front undercarriage can be normally placed down. After taking off, the upper cover and lower cover close to form a cavity in the rocket body, and the cavity is then filled with liquid from the liquid tank in the carrier aircraft. The configuration is similar to the Roton carrier rocket.

Подробнее
Номер записи: 36
24-02-2022 дата публикации

Video display method, video display system, electronic device, and storage medium

Номер: US20220059053A1
Автор: Gangyi Ding, Lijie Li, Mingxiang Tang, Peng Li, Tianyu Huang
Принадлежит: Beijing Institute of Technology BIT

A video display method includes: acquiring at least one frame image corresponding to a current display time point in at least one source video; reading a stage configuration file, obtaining a stage modeling parameter of the stage space at the current display time point and a corresponding relationship between the at least one frame image and the stage space according to a specific stage related parameter in the stage configuration file; according to the stage modeling parameter and the corresponding relationship, processing the at least one frame image to obtain divided regions corresponding to all display screens included in the at least one stage plane; determining display contents corresponding to the divided regions, and copying the display contents to at least one target memory; and outputting a content in the at least one target memory to the at least one stage plane for display.

Подробнее
Номер записи: 37
16-02-2017 дата публикации

Method for synthesis of polymer containing multiple epoxy groups

Номер: US20170044304A1
Автор: Cai Shengying, GAO CHAO, Peng Li, Weng Zhulin, Zheng Yaochen
Принадлежит:

A method for a synthesis of a polymer containing multiple epoxy groups includes steps of: under protection of nitrogen or argon, with a photosensitive free radical initiator under an ultraviolet light irradiation, initiating a mixture of a dithiol compound and alkynyl glycidyl ether or other alkynyl-containing compounds to proceed a thiol-yne polymerization, so as to obtain the polymer. The number of the epoxy groups is able to be adjusted through changing a type of a dithiol monomer, a mixing ratio of the dithiol monomer, and a mixing ratio between the alkynyl glycidyl ether and other alkynyl compounds. The present invention has advantages of: fast reaction, convenient process, easy post-processing, a large number of the epoxy groups, and adjustable and controllable content. The obtained polymer has a wide potential application in fields of coating, adhesive, ink, encapsulating material, resin for composite material, additive, high performance material, function material, and so on. 1under protection of nitrogen or argon, successively adding 1 mole of substance A, 0.5-10 moles of solvent, 0.9-1.1 moles of substance B, and 0.005-0.05 moles of photosensitive free radical initiator into a reactor; irradiating with an ultraviolet light for 0.5-4.0 hours; and, after precipitating, separating, and drying, obtaining the polymer containing the multiple epoxy groups; wherein:the substance A is obtained through mixing at least one member selected from a group consisting of 1,3-propanedithiol, 1,4-butanedithiol, 1,5-pentanedithiol, 1,6-hexanedithiol, 1,8-octanedithiol, 3,6-dioxa-1,8-octanedithiol, bis(2-mercaptoethyl) ether, butylene glycol b is (3-mercaptopropionate), 2,3-dimercapto-1-propanol and 1,4-dithiothreitol in any proportion;the substance B is alkynyl glycidyl ether or a mixture of the alkynyl glycidyl ether and a substance C; and, the substance C is obtained through mixing at least one member selected from a group consisting of 1-octyne, 1-hexyne, undecyne, ...

Подробнее
Номер записи: 38
25-02-2021 дата публикации

MULTI-SCALE AWARE PEDESTRIAN DETECTION METHOD BASED ON IMPROVED FULL CONVOLUTIONAL NETWORK

Номер: US20210056351A1
Автор: Liu Hui, Peng Li, WEN Jiwei, XIE Linbai
Принадлежит:

The present invention relates to the field of pedestrian detection, and particularly relates to a multi-scale aware pedestrian detection method based on an improved full convolutional network. Firstly, a deformable convolution layer is introduced in a full convolutional network structure to expand a receptive field of a feature map. Secondly, a cascade-region proposal network is used to extract multi-scale pedestrian proposals, discriminant strategy is introduced, and a multi-scale discriminant layer is defined to distinguish pedestrian proposals category. Finally, a multi-scale aware network is constructed, a soft non-maximum suppression algorithm is used to fuse the output of classification score and regression offsets by each sensing network to generate final pedestrian detection regions. Experiments show that there is low detection error on the datasets Caltech and ETH, and the proposed algorithm is better than the current detection algorithms in terms of detection accuracy and works particularly well with far-scale pedestrians. 1. A multi-scale aware pedestrian detection method based on an improved full convolutional network , comprising:normalizing the size of an input image into predetermined pixels, inputting the image into an RoI data layer of a ResNet-50 network to learn pedestrian features;extracting pedestrian regions in the image by using first four layers of the ResNet-50 network, to generate feature maps with different scales;{'sub': '0', 'introducing a deformable convolution layer and an offset layer into a res5a_branch2b layer, a res5b_branch2b layer, and a res5c_branch2b layer of the ResNet-50 network, respectively, wherein the size of a convolution kernel is 3×3, the expansion size is 2, the step size is 1, and the pad is 2, and outputting a multi-scale feature map y(p);'}adding one randomly initialized 1×1 convolution to the last layers of C3, C4, and C5 respectively, and reducing an eventual output channel scale to 1024 dimensions, to implement ...

Подробнее
Номер записи: 39
15-05-2014 дата публикации

Film stripping mechanism

Номер: US20140130987A1
Автор: Chunpei SUN, Lingmian MENG, Peng Li, Tao Wang, Yelei XIA
Принадлежит: BOE Hebei Mobile Display Technology Co Ltd, BOE Technology Group Co Ltd

A film stripping mechanism, comprising: a base; a platform disposed on the base and having a substrate to be stripped of film placed thereon; a blade disposed above an upper surface of the platform and capable of contacting the substrate to be stripped of film placed on the platform, the platform and the blade being movable relative to each other so as to strip off a film on the substrate to be stripped of film; an automatic alcohol-spraying module contacting the blade for spraying outwards alcohol and allowing the alcohol to flow toward the substrate to be stripped of film along the blade. The film stripping mechanism can improve the yield rate of film stripping and the stripping efficiency, and reduce breakage rate of the substrates.

Подробнее
Номер записи: 40
04-03-2021 дата публикации

A SEMICONDUCTOR DEVICE HAVING MICROELECTROMECHANICAL SYSTEMS DEVICES WITH IMPROVED CAVITY PRESSURE UNIFORMITY

Номер: US20210060610A1
Автор: CHEN Hsiang-Fu, Chiu I-Hsuan, HUNG Chia-Ming, Peng Li-Chun
Принадлежит:

Various embodiments of the present disclosure are directed towards a semiconductor device. The semiconductor device includes an interconnect structure disposed over a semiconductor substrate. A dielectric structure is disposed over the interconnect structure. A plurality of cavities are disposed in the dielectric structure. A microelectromechanical system (MEMS) substrate is disposed over the dielectric structure, where the MEMS substrate comprises a plurality of movable membranes, and where the movable membranes overlie the cavities, respectively. A plurality of fluid communication channels are disposed in the dielectric structure, where each of the fluid communication channels extend laterally between two neighboring cavities of the cavities, such that each of the cavities are in fluid communication with one another. 1. A semiconductor device , comprising:an interconnect structure disposed over a semiconductor substrate;a dielectric structure disposed over the interconnect structure;a plurality of cavities disposed in the dielectric structure and disposed in an array comprising rows and columns;a microelectromechanical system (MEMS) substrate disposed over the dielectric structure, wherein the MEMS substrate defines upper surfaces of the cavities, wherein the MEMS substrate comprises a plurality of movable membranes, and wherein the movable membranes overlie the cavities, respectively; anda plurality of fluid communication channels disposed in the dielectric structure, wherein upper surfaces of the fluid communication channels are defined by the MEMS substrate, and wherein each of the fluid communication channels extend laterally between two neighboring cavities of the cavities, such that each of the cavities are in fluid communication with one another.2. The semiconductor device of claim 1 , wherein each of the cavities have substantially the same cavity pressure.3. The semiconductor device of claim 1 , wherein each of the cavities have a top-view outline that is ...

Подробнее
Номер записи: 41
04-03-2021 дата публикации

SCREENING AND CONFIRMATION METHOD FOR VETERINARY DRUGS AND ADDITIVES IN ANIMAL-DERIVED FOOD

Номер: US20210063375A1
Автор: GAO Yanling, LI Huisu, LI Lingping, MENG Lei, Peng Li, SU Xiaoou, Wang Peilong, WU Ningpeng, Wu Zhiming, Yang Jie, Yuan Cong, ZHANG Panpan
Принадлежит:

A screening and confirmation method for veterinary drugs and additives in animal-derived food, including: preparation of standard working solution, pretreatment of samples to be tested, establishment of database, sample detection, compound screening and compound confirmation. The disclosure employs ultra high performance liquid chromatography-quadrupole/electrostatic field orbitrap high resolution mass spectrometry, and enables the simultaneous detection of 207 veterinary drugs and additives in animal-derived food within 22 min. 2. The screening and confirmation method of claim 1 , wherein in step (3) claim 1 , when the sample is muscle or poultry egg claim 1 , the extracting solution is a mixed solution of 3.0 mL of Mcllvaine-NaEDTA buffered solution and 10 mL of acetonitrile claim 1 , where a concentration of EDTA in the Mcllvaine-NaEDTA buffered solution is 0.1 mol/L; when the sample is cow's milk or goat's milk claim 1 , the extracting solution is 20 mL of acetonitrile.3. The screening and confirmation method of claim 1 , wherein in step (4) claim 1 , the solid phase extraction column is a HyperSep Retain PEP column.5. The screening and confirmation method of claim 1 , wherein in steps (5) and (6) claim 1 , conditions of the mass spectrometry are:ion source: electron spray ion source (ESI+ and ESI−);scan mode: full scan and automatically triggered secondary scan mode;capillary voltage: 3.2 kv (ESI+) and 2.8 kv (ESI−);ion transmission capillary temperature: 325° C.;atomizing gas temperature: 350° C.;sheath gas pressure: 40 arb;auxiliary gas pressure: 40 arb;dwell time of the primary mass spectrometry: 100 ms;dwell time of the secondary mass spectrometry: 60 ms;scanning range (m/z): 50-1000; andcollision energy: 20, 40 and 60 eV.6. The screening and confirmation method of claim 1 , wherein in step (3) claim 1 , the shaking is performed at 6 claim 1 ,000 rpm for 10 min; and the centrifugation is performed at 4 claim 1 ,000-7 claim 1 ,000 rpm for 5 min. This ...

Подробнее
Номер записи: 42
05-03-2015 дата публикации

System and method for authorization and authentication, server, transit terminal

Номер: US20150067892A1
Автор: Fengrui ZUO, Jinbing YAN, Peng Li, Wei Wang, Yingyu Liu
Принадлежит: Founder Apabi Technology Ltd, Peking University Founder Group Co Ltd

System for authorization and authentication comprises a server and at least one level of transit terminals. The server transmits digital content, server's identifier, and business pattern to the transit terminal. The transit terminal transmits to a lower level transit terminal the digital content, the server's identifier, the business pattern, and identifiers of respective transit terminals through which the digital content passes, and returns the above identifiers to the server. The server performs a match verification on the returned identifiers; if matched, the transit terminal is permitted to parse the business pattern and authorize a client to use the digital content based on privilege in the business pattern.

Подробнее
Номер записи: 43
17-03-2022 дата публикации

Heating device

Номер: US20220086969A1
Автор: Haijuan WANG, Kunkun ZHAO, Peng Li, Xiaobing Zhu
Принадлежит: Haier Smart Home Co Ltd

Disclosed is a heating device (100), including a cylinder body (110) provided with a pick-and-place opening, a door body (120) configured to open and close the pick-and-place opening, and an electromagnetic generating system. At least a part of the electromagnetic generating system is disposed in the cylinder body (110) or accessed into the cylinder body (110), so as to generate electromagnetic waves in the cylinder body (110) to heat an object to be processed. The heating device (100) further includes plastic components (130, 140) disposed on a propagation path of the electromagnetic waves. The plastic components (130, 140) are made of a non-transparent PP material to reduce the electromagnetic loss of the electromagnetic waves on the plastic components (130, 140) so as to indirectly increase the ratio of the electromagnetic waves acting on the object to be processed, thereby increasing the heating rate of the object to be processed.

Подробнее
Номер записи: 44
24-03-2022 дата публикации

Bicolored plant cultivation apparatus

Номер: US20220087122A1
Автор: Huaqin GONG, Jing Li, Peng Li, Shaohua Li, YING Chen, Zhiyin LI
Принадлежит: Fujian Sanan Sino Science Photobiotech Co Ltd

The disclosure discloses a bicolored plant cultivation apparatus. It contains two parts: a cultivation tank and a planting plate which can be assembled as a cavity for storing nutrient solutions and nutrient aerosols, or both can be used separately. In order to create a dark environment inside the cavity, the surface of inner bottom and lateral walls of the cultivation tank, the lower surface of the planting plate, or at least one of them will be coated with one layer of light blocking material. The principle behind the disclosure is to minimize the light intensity below the planting plate in order to provide a low light environment which is suitable for plant root growth and inhibits the alga growth at the same time. The preparation methods of the light-blocking layer include coating, injection moulding, lamination, adhesion and spraying.

Подробнее
Номер записи: 45
11-03-2021 дата публикации

Electronic device

Номер: US20210075121A1
Автор: Peng Li, Xuwang CUI
Принадлежит: Beijing Xiaomi Mobile Software Co Ltd

The disclosure relates to an electronic device, including a device body; a flexible screen assembled on the device body; and an antenna component assembled on the device body. A bent display status of the flexible screen matches with a contracted status of the device body, and an unfolded display status of the flexible screen matches with an extended status of the device body, so that the electronic device can be used in contraction and extension statuses. Furthermore, the main board of the device body can control at least one radiating element of the antenna component to form a first antenna scheme when the device body is in the extended status, and form a second antenna scheme when the device body is in the contracted status.

Подробнее
Номер записи: 46
18-03-2021 дата публикации

Devices and processes for mass spectrometry utilizing vibrating sharp-edge spray ionization

Номер: US20210082677A1
Автор: Lisa Holland, Peng Li, Stephen J. Valentine, Xiaojun Li
Принадлежит: WEST VIRGINIA UNIVERSITY

In accordance with the purpose(s) of the present disclosure, as embodied and broadly described herein, the disclosure, in one aspect, relates to a vibrating sharp edge spray ionization (VSSI) method suitable for coupling with a mass spectrometer, a VSSI method modified with a capillary suitable for use with continuous-flow separation methods such as liquid chromatography, and a VSSI method suitable for coupling with a capillary electrophoresis (CE) device in order to introduce the CE sample flow into a mass spectrometer. Also disclosed herein are devices for carrying out these methods and methods of making the same. This abstract is intended as a scanning tool for purposes of searching in the particular art and is not intended to be limiting of the present disclosure.

Подробнее
Номер записи: 47
25-03-2021 дата публикации

Sensor support systems and methods

Номер: US20210088669A1
Автор: NAN Wu, Peng Li
Принадлежит: Beijing Tusimple Technology Co Ltd

Methods, apparatus and systems that relate to a sensor bracket, a sensor assembly that includes the sensor bracket, as well as movable objects and vehicles equipped with the sensor assembly are described. One example sensor bracket includes a bracket body having a first end and a second end. The first end of the bracket body is configured to connect to an automobile and the second end of the bracket body is configured to connect to a sensor. A first air curtain machine is positioned at the second end of the bracket body, the first air curtain machine having an air outlet that is positioned to cause air to flow from the first air curtain machine through the air outlet across a forward-facing direction of the sensor.

Подробнее
Номер записи: 48
29-03-2018 дата публикации

Methods And Apparatus For Automated Adaptation Of Transmitter Equalizer Tap Settings

Номер: US20180091181A1
Автор: Donald Alderrou, Peng Li, Weiqi Ding
Принадлежит: Altera Corp

One embodiment relates to a method of automated adaptation of a transmitter equalizer. A multi-dimensional search space of tap settings for the transmitter equalizer is divided into multiple single-dimensional search spaces, each single-dimensional search space being associated with a single tap of the transmitter equalizer. The multiple single-dimensional search spaces are searched in series, and a tap for a single-dimensional search space is set before searching a next single-dimensional search space. Another embodiment relates to a transceiver with adaptation circuitry configured to perform this method. Other embodiments, aspects, and features are also disclosed.

Подробнее
Номер записи: 49
09-06-2022 дата публикации

COMBINATION THERAPIES USING ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES

Номер: US20220177554A1
Автор: Bezabeh Binyam, CHOWDHURY Partha S., Damschroder Melissa, DIGIANDOMENICO Antonio, Dimasi Nazzareno, Fleming Ryan, GAO CHANGSHOU, GAO Cuihua, Guillard SAndrine, Minter Ralph, Peng Li, RAINEY GODFREY, Rust Steven, SELLMAN Bret, Stover Charles, Tomich Mladen, Varkey Reena, Venkatraman Vignesh, Warrener Paul
Принадлежит:

This disclosure relates to combination therapies comprising anti-Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of infection. 173-. (canceled)74PseudomonasPseudomonas. An isolated antibody or antigen-binding fragment thereof that specifically binds to PcrV , wherein the antibody or antigen-binding fragment thereof binds to the same PcrV epitope as a reference antibody comprising a heavy chain variable region (VH) comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a light chain variable region (VL) comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263).75. The isolated antibody or antigen-binding fragment thereof of claim 74 , wherein the antibody or antigen-binding fragment thereof comprises:(a) a heavy chain complementarity-determining region (CDR)1 comprising SYAMN (SEQ ID NO:218); a heavy chain CDR2 comprising AITMSGITAYYTDDVKG (amino acids 50-66 of SEQ ID NO:264); and a heavy chain CDR3 comprising EEFLPGTHYYYGMDV (SEQ ID NO: 220); and(b) a light chain CDR1 comprising RASQGIRNDLG (SEQ ID NO: 221); a light chain CDR2 comprising SASTLQS (SEQ ID NO: 222); and a light chain CDR3 comprising LQDYNYPWT (SEQ ID NO: 223).76PseudomonasPseudomonas. An isolated antibody or antigen-binding fragment thereof that specifically binds to PcrV claim 74 , wherein the antibody or antigen-binding fragment thereof competitively inhibits PcrV binding by a reference antibody comprising a VH comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a VL comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF ...

Подробнее
Номер записи: 50
17-07-2014 дата публикации

MAGNETIC HEAD, HEAD GIMBAL ASSEMBLY AND DISK DRIVE UNIT WITH THE SAME, AND MANUFACTURING METHOD THEREOF

Номер: US20140198411A1
Автор: CHOU Shen kuang Sidney, PENG Li ping, WANG Yan bin, XIAO Lu, YUEN Chi hung
Принадлежит: SAE Magnetics (H.K.) Ltd.

A magnetic head includes a slider substrate having a trailing edge and multiple bonding pads arranged on the trailing edge in a row. Each of the bonding pads includes a seed layer adhered to the trailing edge and electrically connected with the slider substrate, a soldering layer formed on the seed layer and adapted for connecting with a suspension, and at least one solder nonwettable layer adhered to the trailing edge and connected with at least one side of the seed layer. The structure of the magnetic head is simple and stable, which can prevent the bonding pads bridging and shorting-circuit. An HGA and a disk drive unit with the same, a manufacturing method for the magnetic head are also disclosed. 1. A magnetic head , comprising a slider substrate having a trailing edge and multiple bonding pads arranged on the trailing edge in a row;wherein each of the bonding pads comprises a seed layer adhered to the trailing edge and electrically connected with the slider substrate, a soldering layer formed on the seed layer and adapted for connecting with a suspension, and at least one solder nonwettable layer adhered to the trailing edge and connected with at least one side of the seed layer, wherein the solder nonwettable layer has the same thickness with the seed layer, so that their top surfaces are in the same level.2. The magnetic head according to claim 1 , wherein the seed layer has the same width with the soldering layer.3. (canceled)4. The magnetic head according to claim 1 , wherein the solder nonwettable layer has a thickness larger than that of the seed layer.5. The magnetic head according to claim 1 , wherein the slider substrate further comprises an over coat layer having the trailing edge claim 1 , and the seed layer electrically connects with a conductive column embedded in the over coat layer.6. The magnetic head according to claim 1 , wherein each of the bonding pads further comprises an enhancing layer sandwiched between the seed layer and the soldering ...

Подробнее
Номер записи: 51
09-04-2020 дата публикации

Adaptive polling in software-defined networking (sdn) environments

Номер: US20200112500A1
Автор: Dexiang WANG, Peng Li, Sreeram RAVINOOTHALA, Xinghua Hu, Yong Wang
Принадлежит: VMware LLC

Example methods are provided for a network device to perform adaptive polling in a software-defined networking (SDN) environment. One example method may comprise: operating in a polling mode at a current polling round to detect zero or more packets that require packet processing by the network device. The method may also comprise: determining packet characteristic information associated with multiple polling rounds that include the current polling round and one or more previous polling rounds; and based on the packet characteristic information, determining whether a resource performance condition associated with the network device is satisfied. In response to determination that the resource performance condition is satisfied, the network device may operate in the polling mode at a subsequent polling round; but otherwise, switch from the polling mode to an interrupt mode.

Подробнее
Номер записи: 52
24-07-2014 дата публикации

Organic compounds

Номер: US20140205596A1
Автор: John Tomesch, Lawrence P. Wennogle, Peng Li, Qiang Zhang, Youyi Peng
Принадлежит: Intra Cellular Therapies Inc

The invention relates to compounds and methods of treatment relating to nicotinic receptor antagonists. For example, the compounds and methods of treatment function block the activity of certain acetylcholine receptors and subtypes therein, and are useful treating diseases and conditions mediated by nicotinic receptor stimulation, e.g., small cell lung cancer.

Подробнее
Номер записи: 53
12-05-2016 дата публикации

Substituted benzofuran compounds and methods of use thereof for the treatment of viral diseases

Номер: US20160130259A1
Автор: Anandan Palani, DONG Xiao, HONG Liu, Peng Li, Qun Dang, Ravi Nargund, Shuwen He, XING Dai, Xuanjia Peng
Принадлежит: Merck Sharp and Dohme LLC

The present invention relates to compounds of formula I that are useful as hepatitis C virus (HCV) NS5B polymerase inhibitors, the synthesis of such compounds, and the use of such compounds for inhibiting HCV NS5B polymerase activity, for treating or preventing HCV infections and for inhibiting HCV viral replication and/or viral production in a cell-based system.

Подробнее
Номер записи: 54
16-04-2020 дата публикации

Thawing method for thawing device

Номер: US20200120765A1
Автор: Jianbin DAI, Ming Wang, Peng Li, Tong Xu, Xiaobing Zhu
Принадлежит: Haier Smart Home Co Ltd

A thawing method for a thawing device includes: generating a radio frequency signal; acquiring the radio frequency signal; an upper electrode plate and a lower electrode plate of the thawing chamber generating, according to the radio frequency signal, radio frequency waves having a corresponding frequency in a thawing chamber and thawing an object to be processed, obtaining voltages and currents of the incident wave signal and reflected wave signal, and determining a thawing progress of the object to be processed.

Подробнее
Номер записи: 55
31-07-2014 дата публикации

Intestinal hyperpermeability and prevention of systemic disease

Номер: US20140213534A1
Автор: Adam E. Snook, Jieru Egeria Lin, Peng Li, Scott A. Waldman
Принадлежит: THOMAS JEFFERSON UNIVERSITY

Compositions for and methods of preventing or reducing the severity intestinal hyperpermeabilization in an individual are disclosed. Compositions for and methods of preventing or reducing the severity of a disease or condition caused or exacerbated by intestinal hyperpermeabilization in an individual identified as being at risk of a disease or condition caused or exacerbated by intestinal hyperpermeabilization are also disclosed. Compositions for and methods of treating an individual who has been identified as having a disease or condition caused or exacerbated by intestinal hyperpermeabilization are additionally disclosed.

Подробнее
Номер записи: 56
31-07-2014 дата публикации

Tetracyclic heterocycle compounds and methods of use thereof for the treatment of viral diseases

Номер: US20140213571A1
Автор: Anandan Palani, Casey Cameron Mccomas, Clare London, DONG Xiao, Frank Narjes, Hao Wu, HONG Liu, Joerg Habermann, Nicolas Zorn, Nigel J. Liverton, Peng Li, Ravi Nargund, Richard Soll, Shuwen He, Uwe Koch, XING Dai, Xuanjia Peng, Zhong Lai
Принадлежит: Merck Sharp and Dohme LLC, MSD Italia SRL, Wuxi Apptec Co Ltd

The present invention relates to compounds of formula (I) that are useful as hepatitis C virus (HCV) NS5B polymerase inhibitors, the synthesis of such compounds, and the use of such compounds for inhibiting HCV NS5B polymerase activity, for treating or preventing HCV infections and for inhibiting HCV viral replication and/or viral production in a cell-based system.

Подробнее
Номер записи: 57
01-09-2022 дата публикации

Video display method for slicing screen, video display device, computer apparatus, and medium

Номер: US20220276773A1
Автор: Guangyu SHAO, Hong Wang, Peng Li, Shuyi Li, Wenjuan Li, Xiaoyang Wang, Yang Qin
Принадлежит: BOE Technology Group Co Ltd

The present disclosure provides a multi-screen video display method, a video display device, a computer apparatus, and a medium. The video display method includes: selecting in response to a first operation and a second operation of a user, a start point and an end point in a multi-screen control icon of a graphical user interface, and showing a sub-layout according to the start point and the end point, wherein the multi-screen control icon comprises multiple sub-icons, the sub-icons are objects respectively mapping sub-screens in the multi-screen display to the graphical user interface, and the sub-layout comprises all covered sub-icons from the start point to the end point; determining the sub-layout in response to a third operation of the user; and generating a video display template in response to a fourth operation of the user, and showing a video display on the graphical user interface.

Подробнее
Номер записи: 58
03-06-2021 дата публикации

Frequency Scaling Method And Apparatus And Computer-Readable Storage Medium

Номер: US20210165477A1
Автор: Nianxian LIN, Peng Li, Qing Ding
Принадлежит: Huawei Technologies Co Ltd

This application provides a frequency scaling method. The method includes: predicting an energy efficiency parameter for processing a current frame of an image by at least one module; and selecting, from a plurality of frequency sets based on the predicted energy efficiency parameter, a first frequency set that meets an energy efficiency requirement, and scaling a working frequency of each of the at least one module for processing the current frame to a preset frequency corresponding to each of the at least one module. According to the technical solutions provided in the embodiments of this application, a load change requirement can be responded to in time in a frequency scaling process.

Подробнее
Номер записи: 59
18-05-2017 дата публикации

Protective cover for portable electronic device

Номер: US20170142853A1
Автор: Yong-Peng LI, Zhi-Ming WANG
Принадлежит: Individual

A protective cover for a portable electronic device, which is configured for supporting the device and for storing an earphone and cable, includes a casing body, a winding portion, a limiting plate, and a support plate. The device is received in a receiving portion in the casing body and the winding portion protrudes out of one side of the casing body spaced apart from the receiving portion, the winding portion being able to accept the cable of the earphone wound onto it. The limiting plate covers one side of the winding portion spaced apart from the casing body and defining an opening. The support plate covers the opening of the limiting plate and is rotatably coupled to the limiting plate. A ring-shaped accommodating space is defined between the limiting plate and the casing body for receiving the cable of the earphone wound onto the winding portion.

Подробнее
Номер записи: 60
01-06-2017 дата публикации

Air conditioning unit of track vehicle mounted under vehicle

Номер: US20170151961A1
Автор: Bo Yuan, Jianjun XIA, Jianying Liang, Jin You, Jingkai WANG, Lele GAO, Peng Li, Xingwang ZANG, Xinxi ZHOU, Zongchang WANG
Принадлежит: CRRC Qingdao Sifang Co Ltd

An underfloor air conditioning unit of a track vehicle is a unitary air conditioning unit and includes a housing, an inside of the housing being divided into an indoor side and an outdoor side, and a condenser, a condenser fan, and a compressor are mounted in the outdoor side, wherein two side walls, corresponding to air intakes of skirt plates at two sides of an equipment compartment, of the housing are each provided with a condensing air inlet, and a bottom wall of the housing is provided with a condensing air outlet, the condenser fan is arranged close to a position of the condensing air outlet of the bottom wall, the number of the condenser is two, and the two condensers are arranged respectively close to the condensing air inlets at the two sides.

Подробнее
Номер записи: 61
18-06-2015 дата публикации

Organic compounds

Номер: US20150166540A1
Автор: John Charles Tomesch, Lawrence P. Wennogle, Peng Li, Qiang Zhang, Robert Davis, Sharon Mates
Принадлежит: Intra Cellular Therapies Inc

The invention relates to particular substituted heterocycle fused gamma-carbolines, their prodrugs, in free, solid, pharmaceutically acceptable salt and/or substantially pure form as described herein, pharmaceutical compositions thereof, and methods of use in the treatment of diseases involving 5-HT 2A receptor, serotonin transporter (SERT) and/or pathways involving dopamine D 2 receptor signaling systems.

Подробнее
Номер записи: 62
23-05-2019 дата публикации

SEMICONDUCTOR DEVICE

Номер: US20190157510A1
Автор: LAI Huan-Yu, Peng Li-Chi
Принадлежит:

A semiconductor device is provided. The semiconductor device includes a first semiconductor layer; a second semiconductor layer on the first semiconductor layer; an active region between the second semiconductor layer and the first semiconductor layer; an electron blocking structure on the active region; a first In-containing layer between the active region and the electron blocking structure; and a second In-containing layer on the electron blocking structure; wherein the first In-containing layer has a first indium content, the second In-containing layer has a second indium content, and the second indium content is different from the first indium content. 1. A semiconductor device , comprising:a first semiconductor layer;a second semiconductor layer on the first semiconductor layer;an active region between the second semiconductor layer and the first semiconductor layer;an electron blocking structure between the active region and the second semiconductor layer;a first In-containing layer between the active region and the electron blocking structure; anda second In-containing layer between the electron blocking structure and the second semiconductor layer; wherein the first In-containing layer has a first indium content, the second In-containing layer has a second indium content, and the second indium content is different from the first indium content.2. The semiconductor device according to claim 1 , wherein the electron blocking structure comprises a third semiconductor having an energy gap claim 1 , the active region comprises alternating well layers and barrier layers claim 1 , and the energy gap of the electron blocking layer is greater than an energy gap of one of the barrier layers.3. The semiconductor device according to claim 2 , wherein the electron blocking structure is in direct contact with the first In-containing layer claim 2 , and the first indium content is greater than the second indium content.4. The semiconductor device according to claim 1 , ...

Подробнее
Номер записи: 63
24-06-2021 дата публикации

METHOD FOR MATRIX DATA BROADCAST IN PARALLEL PROCESSING

Номер: US20210191758A1
Автор: Peng Li, TANG Chi, Yang Jian
Принадлежит:

Systems, apparatuses, and methods for efficient parallel execution of multiple work units in a processor by reducing a number of memory accesses are disclosed. A computing system includes a processor core with a parallel data architecture. One or more of a software application and firmware implement matrix operations and support the broadcast of shared data to multiple compute units of the processor core. The application creates thread groups by matching compute kernels of the application with data items, and grouping the resulting work units into thread groups. The application assigns the thread groups to compute units based on detecting shared data among the compute units. Rather than send multiple read access to a memory subsystem for the shared data, a single access request is generated. The single access request includes information to identify the multiple compute units for receiving the shared data when broadcasted. 1. An apparatus comprising:a first interface configured to communicate with a processor comprising a plurality of compute units, each configured to process instructions; and receive, via the first interface, a first access request from one of the multiple compute units targeting the shared data; and', 'convey a single access request targeting shared data requested by multiple compute units of a plurality of compute units, in response to determining a qualifying condition is satisfied., 'circuitry configured to2. The apparatus as recited in claim 1 , wherein the qualifying condition is a count of access requests targeting the shared data is equal to a number of compute units requiring the shared data.3. The apparatus as recited in claim 1 , wherein the circuitry is configured to:increment a count of access requests for each access request received from the processor targeting the shared data; anddetermine the qualifying condition is satisfied, responsive to determining the count is equal to a sum of the given compute unit and the one or more other ...

Подробнее
Номер записи: 64
24-06-2021 дата публикации

MATRIX DATA BROADCAST ARCHITECTURE

Номер: US20210191761A1
Автор: Peng Li, TANG Chi, Yang Jian
Принадлежит:

Systems, apparatuses, and methods for efficient parallel execution of multiple work units in a processor by reducing a number of memory accesses are disclosed. A computing system includes a processor core with a parallel data architecture. The processor core executes a software application with matrix operations. The processor core supports the broadcast of shared data to multiple compute units of the processor core. A compiler or other code assigns thread groups to compute units based on detecting shared data among the compute units. Rather than send multiple read accesses to a memory subsystem for the shared data, the processor core generates a single access request. The single access request includes information to identify the multiple compute units for receiving the shared data when broadcasted by the processor core. 1. A computing system comprising:a processor comprising a plurality of compute units, each configured to process instructions;a control block; and detecting a first access request from one of the multiple compute units targeting the shared data; and', 'determining a qualifying condition is satisfied; and, 'convey a single access request targeting shared data requested by multiple compute units of the plurality of compute units, in response to, 'wherein the control block is configured tobroadcast the shared data to the multiple compute units, in response to receiving the shared data.2. The computing system as recited in claim 1 , wherein the single access request is conveyed to a first cache controller and the shared data is received from a second cache controller.3. The computing system as recited in claim 1 , wherein the qualifying condition is a count of access requests targeting the shared data is equal to a number of compute units requiring the shared data.4. The computing system as recited in claim 3 , wherein the control block is configured to increment a count of access requests claim 3 , responsive to detecting an access request targeting ...

Подробнее
Номер записи: 65
30-05-2019 дата публикации

COSET PARTITION BASED CONSTRUCTION METHOD FOR (n,n(n-1),n-1) PERMUTATION GROUP CODE AND CODE SET GENERATOR THEREOF

Номер: US20190165814A1
Автор: LI Gaofeng, LIANG Kun, Peng Li, WEI Jiaolong, ZHOU Bo
Принадлежит:

A construction method for a (n,n(n−1),n−1) permutation group code based on coset partition is provided. The presented (n,n(n−1),n−1) permutation group code has an error-correcting capability of d−1 and features a strong anti-interference capability for channel interferences comprising multi-frequency interferences and signal fading. As n is a prime, for a permutation code family with a minimum distance of n−1 and a code set size of n(n−1), the invention provides a method of calculating n−1 orbit leader permutation codewords by O={αo}(mod n) and enumerating residual codewords of the code set by P=CO={(l)O}={(r)O}. Besides, a generator of the code set thereof is provided. The (n,n(n−1),n−1) permutation group code of the invention is an algebraic-structured code, n−1 codewords of the orbit leader array can be obtained simply by adder and (mod n) calculator rather than multiplication of positive integers. Composition operations of the cyclic subgroup Cacting on all permutations o of the orbit leader permutation array Oare replaced by well-defined cyclic shift composite operation functions (l)and (r)so that the action of the cyclic group acting on permutations is realized by a group of cyclic shift registers. 1. A construction method of the (n ,n(n−1) ,n−1) permutation group codes based on coset partition , wherein a construction of this permutation code with a code length of n , a minimum distance of n−1 and a code size of n(n−1) is expressed by P={{p}}=CO={{Co} , {Co} , . . . , {Co}}={{c∘o}} , P=COrepresents that Cis a coset of the subgroup Oand Ois also a coset of the subgroup C , P={{Co} , {Co} , . . . , {Co}} represents dividing Pinto n−1 cosets by the subgroup C , each coset {Co} forms an orbit or an cyclic Latin square (C-LS) of a permutation o , P={{p}}={{c∘o}}represents a permutation code and each codeword p is generated by composition operation of a permutation c of the subgroup Cand a permutation o of the subgroup O , α=1 , 2 , . . . n−1 , and β=1 , 2 , . . . ...

Подробнее
Номер записи: 66
01-07-2021 дата публикации

Mobile terminal and drop protection method thereof

Номер: US20210203764A1
Автор: Jiong Huang, Lele HAN, Peng Li, Wei Xu
Принадлежит: BOE Technology Group Co Ltd, Hefei BOE Optoelectronics Technology Co Ltd

Provided are a mobile terminal and a drop protection method thereof. The mobile terminal includes a display panel, a middle frame, a rear shell, a protection module and a detection module; the middle frame being mounted in the rear shell; and the display being arranged on the middle frame. The protection module includes a buffer elastic block mounted on the middle frame and an elastic block control unit for controlling buffer elastic block to eject out if the mobile terminal is in a drop state. At the instant of dropping down to the ground, the buffer elastic block absorbs a generated momentum reduces instant impact stress of mobile terminal, thereby protecting modules, and preventing stress concentration. Since buffer elastic block is arranged on middle frame, the mobile terminal is better protected, and damages to the screen and the internal modules caused by drop of the mobile terminal are be avoided.

Подробнее
Номер записи: 67
08-07-2021 дата публикации

Dental floss stick

Номер: US20210205060A1
Автор: Peng Li
Принадлежит: Individual

The invention discloses a dental floss stick, comprising an upper piece and a lower piece, wherein both the upper piece and the lower piece are U-shaped; the top of both ends of the opening of the upper piece and the top of both ends of the opening of the lower piece (are rotatably connected; the upper part of both ends of the opening of the upper piece is provided with a bulge, and the upper part of both ends of the opening of the lower piece is provided with a groove corresponding to the bulge; the middle part of the upper piece is provided with a female buckle, and the middle part of the lower piece is provided with a male buckle matching the female buckle; the upper part of both ends of the opening of the upper piece is provided with a dental floss.

Подробнее
Номер записи: 68
28-06-2018 дата публикации

Jak inhibitors

Номер: US20180179209A1
Автор: Fei Wang, Hao Wu, JIAN Li, Peng Li, Shuhui Chen, Weiwei Mao
Принадлежит: WUXI FORTUNE PHARMACEUTICAL CO LTD

Disclosed is a series of JAK inhibitors, which specifically relates to a compound shown in formula (I) or pharmaceutically acceptable salts thereof.

Подробнее
Номер записи: 69
08-07-2021 дата публикации

METHOD AND ELECTRONIC DEVICE FOR SELECTING INFLUENCE INDICATORS BY USING AUTOMATIC MECHANISM

Номер: US20210209503A1
Автор: Chen Liang-Kung, Lin Chi-Hung, Lin Wei-Ju, Peng Li-Ning, Tsai Ting-Fen, TSAI Tsung-Hsien, Tsai Zong-Han, Tung Chien-Yi
Принадлежит:

A method and an electronic device for selecting influence indicators by using an automatic mechanism are provided. The method includes following steps. Raw data is obtained, where the raw data includes a body-related variable and a plurality of to-be-measured indicators corresponding to the body-related variable. The body-related variable is set as a target parameter. The body-related variable and the to-be-measured indicators are input into a plurality of validation models, and the to-be-measured indicators are sorted according an output result of the validation models to obtain ranking data. Importance of the to-be-measured indicators is calculated by using a screening condition according to the ranking data, so as to select a candidate indicator from the to-be-measured indicators. An influence indicator is determined by calculating a correlation between the candidate indicator and the body-related variable. 1. A method for selecting influence indicators by using an automatic mechanism , adapted to an electronic device and comprising:obtaining raw data, wherein the raw data comprises a body-related variable and a plurality of to-be-measured indicators corresponding to the body-related variable;setting the body-related variable as a target parameter;inputting the body-related variable and the to-be-measured indicators into a plurality of validation models, and sorting, according to an output result of the validation models, the to-be-measured indicators to obtain ranking data;calculating importance of the to-be-measured indicators by using a screening condition according to the ranking data to select a candidate indicator from the to-be-measured indicators; andcalculating a correlation between the candidate indicator and the body-related variable to determine an influence indicator.2. The method for selecting the influence indicators by using the automatic mechanism according to claim 1 , wherein the step of inputting the body-related variable and the to-be- ...

Подробнее
Номер записи: 70
29-06-2017 дата публикации

MULTI-SPECIFIC ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES AND USES THEREOF

Номер: US20170183397A1
Автор: Bezabeh Binyam, Chowdhury Partha, Damschroder Melissa, DIGIANDOMENICO Antonio, Dimasi Nazzareno, Fleming Ryan, GAO CHANGSHOU, GAO Cuihua, Guillard SAndrine, Minter Ralph, Peng Li, RAINEY GODFREY, Rust Steven, SELLMAN Bret, Stover Charles, Tomich Mladen, Varkey Reena, Venkatraman Vignesh, Warrener Paul
Принадлежит:

This disclosure relates to combination therapies comprising anti-Psl and PcrV bispecific binding molecules and related compositions, for use in prevention and treatment of infection. 1PseudomonasPseudomonas. A bispecific antibody comprising a binding domain that binds to Psl and a binding domain that binds to PcrV.2. The bispecific antibody of claim 1 , wherein the Psl binding domain comprises a scFv fragment and the PcrV binding domain comprises an intact immunoglobulin.3. The bispecific antibody of claim 1 , wherein the Psl binding domain comprises an intact immunoglobulin and the PcrV binding domain comprises a scFv fragment.4. The bispecific antibody of comprising a Bs-2 molecule claim 2 , wherein the scFv is fused to the amino-terminus of the VH region of the intact immunoglobulin.5. The bispecific antibody of comprising a Bs-3 molecule claim 2 , wherein the scFv is fused to the carboxy-terminus of the CH3 region of the intact immunoglobulin.6. (canceled)7. (canceled)8. The bispecific antibody of claim 1 , wherein the anti-Psl binding domain comprises a VH and VL region at least 90% identical to the corresponding region of WapR-004-RAD.9. The bispecific antibody of claim 8 , wherein the WapR-004-RAD VH and VL are arranged as a ScFv.10. (canceled)11. (canceled)12. The bispecific antibody of claim 1 , wherein the anti-PcrV binding domain comprises VH and VL regions at least 90% identical to the corresponding regions of V2L2.13. The bispecific antibody of claim 8 , comprising Bs-2-GLO claim 8 , Bs-3-GLO claim 8 , or Bs-4-GLO.14. A cell comprising or producing the bispecific antibody of .15. An isolated polynucleotide molecule comprising a polynucleotide that encodes the bispecific antibody of .16. A vector comprising the polynucleotide of .17. A cell comprising the vector of .18. A composition comprising the bispecific antibody of and a pharmaceutically acceptable carrier.19. The bispecific antibody of claim 1 , which is conjugated to an agent selected from the ...

Подробнее
Номер записи: 71
04-06-2020 дата публикации

TESTING DEVICE AND METHOD FOR MEASURING ADHESION FORCE BETWEEN GAS HYDRATE AND MINERAL PARTICLES

Номер: US20200174037A1
Автор: CHENG Wan, JIANG GUOSHENG, Li Wei, Liu Zhichao, NING Fulong, OU Wenjia, Peng Li, SUN Jiaxin, Wang Dongdong, Zhang Ling
Принадлежит:

A testing device for testing adhesion force includes a thermal insulated glove box, an atomic force microscope, a cryogenic sample stage, a high pressure gas source and a circulating chiller. The atomic force microscope includes a probe for adhering mineral particles. The cryogenic sample stage is configured for preparing gas hydrate sample. The cryogenic sample stage is arranged below the probe. The atomic force microscope and the cryogenic sample stage are placed in the thermal insulated glove box. The high pressure gas source provides pressure required for synthesis of gas hydrates, the high pressure gas source comprises a high pressure chamber covered on the cryogenic sample stage and a high pressure gas cylinder connected with the high pressure chamber. The circulating chiller, an outlet of the circulating chiller is connected with the thermal insulated glove box to control humidity and temperature inside the thermal insulated glove box. 1. A testing device for testing adhesion force between gas hydrate and mineral particles comprising: a thermal insulated glove box;an atomic force microscope for measuring adhesion force and sticking mineral particles by manipulating the probe; a cryogenic sample stage for preparing gas hydrate sample, the cryogenic sample stage is fixed on the carrier stage of the atomic force microscope, So the cryogenic sample stage can move in the horizontal plane by manipulating the carrier table, wherein the atomic force microscope and the cryogenic sample stage are placed in the thermal insulated glove box;a high pressure gas source provides pressure required for synthesis of gas hydrates, the high pressure gas source comprises a high pressure chamber covered on the cryogenic sample stage and a high pressure gas cylinder connected with the high pressure chamber; anda circulating chiller, an outlet of the circulating chiller is connected with the thermal insulated glove box to control humidity and temperature inside the thermal insulated ...

Подробнее
Номер записи: 72
04-06-2020 дата публикации

COGNITIVE PREDICTIVE ASSISTANCE FOR WORD MEANINGS

Номер: US20200175111A1
Автор: Luo Xiao Guang, Peng Li, QI Yang, ZHANG Gong, Zhang Tao
Принадлежит:

A computer-implemented method for word meaning generation is provided. In this method, a vocabulary notebook is obtained, wherein the vocabulary notebook stores at least one existing word that has been looked up. A concerned category is then identified based on the vocabulary notebook. It will be further determined whether a new page to be displayed contains at least one new word belonging to the concerned category. And responsive to determining that the new page contains the at least one new word, a respective meaning of the at least one new word is generated. 1. A computer-implemented method for word meaning generation , comprising:obtaining a vocabulary notebook, wherein the vocabulary notebook stores at least one existing word that has been looked up;identifying a concerned category based on the vocabulary notebook;determining whether a new page to be displayed on a display of an e-book reader that is communicatively connected to the vocabulary notebook contains at least one new word that is not in the vocabulary notebook and that belongs to the concerned category;responsive to determining that the new page contains the at least one new word, generating a respective meaning of the at least one new word; andautomatically modifying a display of the new page to display the respective meaning of the at least one new word on the display of the e-book reader.2. The method of claim 1 , wherein the at least one existing word is from at least one existing page that has been read claim 1 , and both the at least one existing page and the new page are originated from the same document claim 1 , the method further comprises: a number of the at least one existing page reaches a predefined number of pages,', 'a percentage of the at least one existing pages in the document reaches a predefined percentage,', 'a number of the at least one existing word reaches a predefined number of words, and', 'a percentage of the at least one existing word in the document reaches a predefined ...

Подробнее
Номер записи: 73
27-06-2019 дата публикации

Amorphous solid dispersions

Номер: US20190192511A1
Автор: Peng Li
Принадлежит: Intra Cellular Therapies Inc

The disclosure provides new, stable, pharmaceutically acceptable amorphous solid dispersions of 1-(4-fluoro-phenyl)-4-((6bR,10aS)-3-methyl-2,3,6b,9,10,10a-hexahydro-1H,7H-pyrido[3′,4′:4,5]pyrrolo[1,2,3-de]quinoxalin-8-yl)-butan-1-one, together with methods of making and using them, and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 74
05-08-2021 дата публикации

Novel scfv amino acid sequence, chimeric antigen receptor containing same and application thereof

Номер: US20210238253A1
Автор: Le QIN, Peng Li, Ruocong ZHAO, Simiao LIN, Yao Yao, Yuanbin CUI, Zhaoyang TANG
Принадлежит: Guangdong Zhaotai Invivo Biomedicine Co ltd

The present disclosure relates to a scFv amino acid sequence capable of recognizing CD19 antigen and a nucleotide sequence encoding the same, and also relates to a chimeric antigen receptor, a nucleic acid encoding the same and a cell expressing the same, and their uses in the manufacture of a medicament for treating tumors. The chimeric antigen receptor of the present disclosure comprises at least one extracellular domain, an optional transmembrane domain and at least one intracellular costimulatory signaling domain, wherein the extracellular domain comprises a CD19 antigen-recognizing and binding domain. The chimeric antigen receptor of the present disclosure has been humanized, resulting in a longer survival period in vivo, and a corresponding extended complete remission period in patients.

Подробнее
Номер записи: 75
27-07-2017 дата публикации

CONSTRUCTION METHOD FOR (n,n(n-1),n-1) PERMUTATION GROUP CODE BASED ON COSET PARTITION AND CODEBOOK GENERATOR THEREOF

Номер: US20170214414A1
Автор: LI Gaofeng, LIANG Kun, Peng Li, WEI Jiaolong, ZHOU Bo
Принадлежит:

A construction method for a (n,n(n−1),n−1) permutation group code based on coset partition is provided. The presented (n,n(n−1),n−1) permutation group code has an error-correcting capability of d−1 and features a strong anti-interference capability for channel interferences comprising multi-frequency interferences and signal fading. As n is a prime, for a permutation code family with a minimum distance of n−1 and a code set size of n(n−1), the invention provides a method of calculating n−1 orbit leader permutation codewords by O={αo}(mod n) and enumerating residual codewords of the code set by P=CO={(l)O}={(r)O)}. Besides, a generator of the code set thereof is provided. The (n,n(n−1),n−1) permutation group code of the invention is an algebraic-structured code, n−1 codewords of the orbit leader array can be obtained simply by adder and (mod n) calculator rather than multiplication of positive integers. Composition operations of the cyclic subgroup Cacting on all permutations o of the orbit leader permutation array Oare replaced by well-defined cyclic shift composite operation functions (l)and (r)so that the action of the cyclic group acting on permutations is realized by a group of cyclic shift registers. 1. A construction method of the (n ,n(n−1) ,n−1) permutation group codes based on coset partition , wherein a construction of this permutation code with a code length of n , a minimum distance of n−1 and a code size of n(n−1) is expressed by P={{p}}=CO={{Co} , {Co} , . . . , {Co}}={{c∘o}} , P=COrepresents that Cis a coset of the subgroup Oand Ois also a coset of the subgroup C , P={{Co} , {Co} , . . . , {Co}} represents dividing Pinto n−1 cosets by the subgroup C , each coset {Co} forms an orbit or an cyclic Latin square (C-LS) of a permutation o , P={{p}}={{c∘o}}represents a permutation code and each codeword p is generated by composition operation of a permutation c of the subgroup Cand a permutation o of the subgroup O , α=1 , 2 , . . . n−1 , and β=1 , 2 , . . . ...

Подробнее
Номер записи: 76
03-08-2017 дата публикации

Process for producing aromatic primary diamines

Номер: US20170217916A1
Автор: Floryan Decampo, Peng Li
Принадлежит: Rhodia Operations SAS

A process for the production of aromatic primary amines, by reacting an aromatic dialdehyde with hydrogen and ammonia or an ammonia-liberating compound, in the presence of a hydrogenation catalyst and an amine, wherein the molar ratio of the amine to the aromatic dialdehyde is no less than 1:4 at the start of the reaction.

Подробнее
Номер записи: 77
12-08-2021 дата публикации

IMPEDANCE MATCHING NETWORK OPTIMIZATION METHOD FOR WIRELESS POWER TRANSFER SYSTEM UNDER MAXIMUM EFFICIENCY TRACKING

Номер: US20210249904A1
Автор: FAN Qigao, FENG Hongwei, Peng Li, XIE Linbo
Принадлежит:

An impedance matching network optimization method for a wireless power transfer system under maximum efficiency tracking belongs to the field of wireless power transfer. The present invention proposes a novel impedance matching network optimization method for a WPT system under maximum efficiency. The method analyzes the nonlinearity of a bridge rectifier circuit, the adaptability of load change and other factors related to the maximum efficiency tracking, and provides an important reference for the WPT system in terms of maximum transfer efficiency. 11) structure of wireless power transfer systemthe wireless power transfer system comprises a transmitting end and a receiving end, wherein the transmitting end is connected to a power frequency mains supply and mainly composed of a voltage stabilizing circuit module, a high-frequency inverter module and a transmitting coil; the receiving end supplies power to the load, and is composed of a receiving coil, a T-type impedance matching network and a full-bridge rectifier circuit;{'sub': 1', '1', '1', '1, 'the voltage stabilizing circuit module converts 220 V mains supply to 48 V direct current and performs corresponding smoothing filtering to eliminate harmonic waves in electrical signals, and the voltage stabilizing circuit module is connected with the high-frequency inverter module after outputting; the high-frequency inverter module converts 48 V direct current to high-frequency alternating current, and the high-frequency inverter module is connected with the transmitting coil; the transmitting coil is composed of a resonant capacitor Cand a transmitting coil Lwhich are connected in series, and high-frequency electrical signals output by the high-frequency inverter module cause a series resonant circuit composed of the resonant capacitor Cand the transmitting coil Lto generate resonant voltage and resonant current;'}{'sub': 2', '2', '1', '2', '1', '2', 'i', 'b1', 'b2', 'b', '1', '2', '3', '4', '3', 'L', 'L, 'a ...

Подробнее
Номер записи: 78
17-08-2017 дата публикации

Organic compounds

Номер: US20170231994A1
Автор: Hailin Zheng, Jun Zhao, Lawrence P. Wennogle, Peng Li
Принадлежит: Intra Cellular Therapies Inc

Provided are PDE1 inhibitors of Formula I, processes for their production, their use as pharmaceuticals, and pharmaceutical compositions comprising them.

Подробнее
Номер записи: 79
16-08-2018 дата публикации

Programmable photonic-electronic integrated circuit for optical testing

Номер: US20180234177A1
Автор: Peng Li
Принадлежит: Intel Corp

The present disclosure provides a programmable integrated circuit die for optical testing. The integrated circuit die includes both photonic and electronic elements. In particular, the integrated circuit die may include a memory block, a programmable logic block (for example, a field programmable gate array), an electrical transceiver block, an optical transceiver block, and an optical test interface unit. The programmable logic block may be programmed to have logic functionalities of an embedded microcontroller and of various encoders/decoders. The logic functions may be soft, hard, or mixed. The memory may be used to store test patterns, look-up tables, measured waveforms, error time profiles and statistics. The electrical and optical transceivers may implement PAMn, NRZ, or QAMn modulations and may have programmable parameters, including: voltage levels; optical power; slew rate; magnitude/phase; clock generation and recovery; equalizations; sampling levels; and sampling times. Other embodiments and features are also disclosed.

Подробнее
Номер записи: 80
03-09-2015 дата публикации

Substitued benzofuran compounds and methods of use thereof for the treatment of viral diseases

Номер: US20150246902A1
Автор: Anandan Palani, Casey C. McComas, Frank Narjes, Hao Wu, HONG Liu, Joerg Habermann, Nigel J. Liverton, Peng Li, Qun Dang, Richard Soll, Shuwen He, Uwe Koch, XING Dai, Xuanjia Peng
Принадлежит: Merck Sharp and Dohme LLC, MSD Italia SRL

The present invention relates to compounds of formula (I) that are useful as hepatitis C virus (HCV) NS5B polymerase inhibitors, the synthesis of such compounds, and the use of such compounds for inhibiting HCV NS5B polymerase activity, for treating or preventing HCV infections and for inhibiting HCV viral replication and/or viral production in a cell-based system.

Подробнее
Номер записи: 81
23-07-2020 дата публикации

INDEPENDENT FREE-STANDING GRAPHENE FILM AND METHOD OF PREPARING THE SAME

Номер: US20200231444A1
Автор: GAO CHAO, Peng Li
Принадлежит:

Proposed is a method of preparing an independent free-standing graphene film. The graphene film is obtained by means of suction filtration of graphene oxide into a film, solid phase transfer, chemical reduction and the like steps. The graphene film is formed by means of physical cross-linking of a single layer of oxidized/reduced graphene oxide. The graphene film has a thickness of 10-2000 atomic layers. The graphene oxide film has a small thickness and a large number of defects inside, so that it has good transparency and excellent flexibility. On the basis of the transfer film-forming method above, an independent free-standing wrinkled graphene film having a nanoscale thickness is prepared by using a poor solvent and a special high temperature annealing process, and an independent free-standing foamed graphene film having a nanoscale thickness is obtained by using a film-forming thickness and a special high temperature annealing process. 1. A method of preparing an independent free-standing graphene film , wherein comprising steps of:(1) formulating graphene oxide into an aqueous solution of graphene oxide with a concentration of 0.5-10 ug/mL, and performing suction filtration with mixed cellulose ester (MCE) as a substrate to form a film;(2) placing a graphene oxide film attached to a MCE film in a closed container, and performing fumigation with HI at a high temperature of 60-100 degrees for 1-10 hours;(3) coating a melted solid transfer agent uniformly on a surface of a reduced graphene oxide film by evaporation or casting, and performing cooling at room temperature slowly;(4) placing the graphene film coated with the solid transfer agent in a good solvent for the MCE film, and removing the MCE film by etching; and(5) removing, by volatilizing at a temperature at which the solid transfer agent is volatilizable, the solid transfer agent from the obtained graphene film supported by the solid transfer agent to obtain an independent free-standing graphene film.2. ...

Подробнее
Номер записи: 82
01-08-2019 дата публикации

Concept for storing file system metadata within solid-stage storage devices

Номер: US20190235779A1
Автор: Peng Li
Принадлежит: Intel Corp

Examples relate to a controller apparatus or controller device for a solid-stage storage device, to an apparatus or device for a host computer, to corresponding methods and computer programs, to a solid-stage storage device and to a host computer comprising a solid-state storage device. Examples provide a controller apparatus for a solid-state storage device. The solid-state storage device comprises non-volatile buffer memory circuitry and storage circuitry. The controller apparatus comprises interface circuitry for communicating with a host computer. The controller apparatus comprises processing circuitry configured to obtain a control instruction related to a file system of a partition from the host computer. The partition is at least partially stored within the storage circuitry of the solid-state storage device. The control instruction indicates a location of file system metadata within the partition. The processing circuitry is configured to store the file system metadata within the non-volatile buffer memory circuitry of the solid-state storage device based on the location of the file system metadata.

Подробнее
Номер записи: 83
30-07-2020 дата публикации

Statistical Performance Evaluation Method for Different Grouping Sets by Using Statistical Indicators

Номер: US20200242193A1
Автор: Chen Liang-Kung, CHEN Pei-Jung, Li Wei-Ju, Peng Li-Ning, TSAI Tsung-Hsien
Принадлежит:

A statistical performance evaluation method for different grouping sets includes setting a plurality of first grouping ranges of a first grouping set corresponding to a sample space, setting a plurality of second grouping ranges of a second grouping set corresponding to the sample space, generating a plurality of first probability values and a plurality of first standard deviations corresponding to the plurality of first grouping ranges at each sampling time according to the sample space, generating a plurality of second probability values and a plurality of second standard deviations corresponding to the plurality of second grouping ranges at the each sampling time according to the sample space, and generating a plurality of statistical indicators corresponding to the first grouping set and the second grouping set and outputting a statistical performance ranking result of the first grouping set and the second grouping set accordingly. 1. A statistical performance evaluation method for different grouping sets comprising:setting a plurality of first grouping ranges of a first grouping set corresponding to a sample space;setting a plurality of second grouping ranges of a second grouping set corresponding to the sample space;generating a plurality of first probability values and a plurality of first standard deviations corresponding to the plurality of first grouping ranges at each sampling time according to the sample space;generating a plurality of second probability values and a plurality of second standard deviations corresponding to the plurality of second grouping ranges at the each sampling time according to the sample space; andgenerating a plurality of statistical indicators corresponding to the first grouping set and the second grouping set and outputting a statistical performance ranking result of the first grouping set and the second grouping set accordingly;wherein the sample space is a time-varying random process-based sample space, the plurality of ...

Подробнее
Номер записи: 84
14-10-2021 дата публикации

METHOD FOR ANALYZING ELECTROCARDIOGRAPHY SIGNAL

Номер: US20210315473A1
Автор: Chan Yun-Hsuan, Chen Liang-Kung, Li Wei-Ju, PAN Ke-Han, Peng Li-Ning
Принадлежит:

A method for analyzing an electrocardiography (ECG) signal is provided. The ECG signal is measured through a sensor. One or more specified waveforms in the ECG signal are detected. Multiple ECG features from each specified waveform are captured. The ECG features are input into multiple candidate models to obtain multiple candidate scores. Each candidate score is compared with a standard value to obtain an ideal score among the candidate scores. One of the candidate models corresponding to the ideal score is selected as a risk prediction model to predict disease risk through the risk prediction model. 1. A method for analyzing an electrocardiography (ECG) signal , comprising:measuring an ECG signal through a sensor;detecting one or more specified waveforms in the ECG signal;capturing a plurality of ECG features from each of the specified waveforms;inputting the plurality of ECG features into a plurality of candidate models to obtain a plurality of candidate scores;comparing each of the candidate scores with a standard value to obtain an ideal score among the plurality of candidate scores; andselecting one of the candidate models corresponding to the ideal score as a risk prediction model to predict disease risk through the risk prediction model.2. The method for analyzing an ECG signal according to claim 1 , wherein the step of comparing each of the candidate scores with the standard value comprises:calculating a mean absolute percentage error between each of the candidate scores and the standard value; andusing a candidate score corresponding to a smallest among the mean absolute percentage error as the ideal score.3. The method for analyzing an ECG signal according to claim 2 , further comprising:obtaining the standard value through a proportional risk model.4. The method for analyzing an ECG signal according to claim 1 , wherein each of the specified waveforms comprises a first wave claim 1 , a second wave claim 1 , and a third wave claim 1 , wherein an amplitude ...

Подробнее
Номер записи: 85
24-09-2015 дата публикации

Tft and manufacturing method thereof, array substrate and manufacturing method thereof, x-ray detector and display device

Номер: US20150270299A1
Автор: Huichao Gao, Peng Li, Zongmin Tian
Принадлежит: Beijing BOE Optoelectronics Technology Co Ltd, BOE Technology Group Co Ltd

A TFT and manufacturing method thereof, an array substrate and manufacturing method thereof, an X-ray detector and a display device are disclosed. The manufacturing method includes: forming a gate-insulating-layer thin film ( 3 ′), a semiconductor-layer thin film ( 4 ′) and a passivation-shielding-layer thin film ( 5 ′) successively; forming a pattern ( 5 ′) that includes a passivation shielding layer through one patterning process, so that a portion, sheltered by the passivation shielding layer, of the semiconductor-layer thin film forms a pattern of an active layer ( 4 a ′); and performing an ion doping process to a portion, not sheltered by the passivation shielding layer, of the semiconductor-layer thin film to form a pattern comprising a source electrode ( 4 c ′) and a drain electrode ( 4 b ′). The source electrode ( 4 c ′) and the drain electrode ( 4 b ′) are disposed on two sides of the active layer ( 4 a ′) respectively and in a same layer as the active layer ( 4 a ′). The manufacturing method can reduce the number of patterning processes and improve the performance of the thin film transistor in the array substrate.

Подробнее
Номер записи: 86
29-08-2019 дата публикации

METHOD OF PREPARING HIERARCHICAL POROUS CHANNEL MOLECULAR SIEVE MEMBRANE AND APPLICATION THEREOF

Номер: US20190262779A1
Автор: GU Xuehong, Peng Li, YAO Xun
Принадлежит: NANJING UNIVERSITY OF TECHNOLOGY

The invention relates to a method for preparing a hierarchical porous zeolite membrane and an application thereof, comprising the following steps: a mesoporous structure-directing agent is added to limit the growth of zeolite crystals, and self-assembled in the crystallization process to generate a mesoporous structure. Based on a seed crystal induced secondary nucleation mechanism, this method can realize one-step hydrothermal synthesis of hierarchical porous zeolite membrane with the advantages of mild and controllable synthesis conditions, simple process, good repeatability, reduced energy consumption and cost savings. The hierarchical porous zeolite membrane prepared by the method has good cut-off performance, and the cut-off molecular weight is adjustable between 200 to 500,000 Da. 1. A method for preparing a hierarchical porous zeolite membrane , characterized in that a mesoporous structure-directing agent is introduced and self-assembled on a membrane layer to form a mesoporous structure;comprising the following steps specifically:(1) preparation of seed crystal: zeolite particles are prepared into a seed crystal suspension;(2) seed crystal coating: a continuous and compact seed crystal layer is coated on a porous support by a dip-coating method, dried and calcined to obtain a support coated with the seed crystal;(3) synthesis of hierarchical porous zeolite membrane: a silicon source, an aluminum source, an alkali source, a mesoporous structure-directing agent and deionized water are mixed and prepared into a secondary growth mother liquor; the two ends of a support coated with the seed crystal are sealed and placed in a reaction kettle filled with mother liquor, and then dynamically crystallized through scroll synthesis; finally, the mesoporous structure-directing agent is removed to obtain a hierarchical porous zeolite membrane.2. The method according to claim 1 , characterized in that the silicon source claim 1 , the aluminum source claim 1 , the alkali ...

Подробнее
Номер записи: 87
25-11-2021 дата публикации

Liquid transfer control device and liquid transfer apparatus

Номер: US20210361862A1
Автор: Jiong Huang, Lingxiao HU, Peng Li, Zhen Zhang
Принадлежит: BOE Technology Group Co Ltd, Hefei BOE Optoelectronics Technology Co Ltd

A liquid transfer control device and a liquid transfer apparatus are provided. The liquid transfer control device includes a tube carrier, configured to accommodate at least one portion of a tube, a flow rate sensor, configured to detect a flow rate of liquid transferred in the tube; a regulator, configured to regulate the flow rate of the liquid transferred in the tube; and a controller, configured to output a control signal to the regulator based on the flow rate detected by the flow rate sensor, wherein, the regulator is further configured to, in response to the control signal outputted by the controller, regulate the flow rate of the liquid in the tube accommodated in the tube carrier.

Подробнее
Номер записи: 88
12-09-2019 дата публикации

Novel combination

Номер: US20190275046A1
Автор: Lawrence P. Wennogle, Peng Li
Принадлежит: Intra Cellular Therapies Inc

The invention relates to the combination of inhibitors of phosphodiesterase 1 (PDE1) and inhibitors of Neprilysin (NEP) useful for the treatment of certain cardiovascular diseases or related disorders, e.g., hypertension, congestive heart disease, and post-myocardial infarction. In another embodiment, the invention relates to the combination of inhibitors of PDE1 and inhibitors of NEP for the treatment of diseases or disorders characterized by disruption of or damage to various cGMP/PKG mediated pathways in the cardiovascular system (e.g., in cardiac tissue or in arterial smooth muscle).

Подробнее
Номер записи: 89
23-12-2021 дата публикации

MULTIMERIC PROTEINS FOR DETECTING A CARBOHYDRATE AND/OR TREATING A SIGLEC-MEDIATED DISORDER

Номер: US20210395333A1
Автор: Peng Li, Petrone Adam, Shoemaker Adam, XU Lihui
Принадлежит:

The invention relates generally to polypeptides comprising a lectin domain, multimeric proteins comprising the polypeptides, and use of the polypeptides or multimeric proteins in the detection of a carbohydrate (e.g., a sialic acid containing carbohydrate or Siglec ligand) or the treatment of a Siglec-mediated disorder. 1. An isolated polypeptide comprising:a) a lectin domain;b) a trimerization domain; andc) a dimerization domain.2. The polypeptide of claim 1 , wherein the lectin domain claim 1 , the trimerization domain claim 1 , and the dimerization domain are covalently linked together in an N- to C-terminal orientation.36-. (canceled)7. An isolated polypeptide comprising:a) a first lectin domain;b) a second lectin domain; andc) a dimerization domain.810-. (canceled)11. The polypeptide of claim 1 , wherein the lectin domain comprises a Siglec sialic acid binding V-set immunoglobulin-like domain claim 1 , or a variant thereof.1217-. (canceled)18. The polypeptide of claim 11 , wherein the Siglec is selected from human Siglec-3 claim 11 , Siglec-7 claim 11 , and Siglec-9.19. (canceled)20. The polypeptide of claim 18 , wherein the lectin domain comprises SEQ ID NO: 1 claim 18 , SEQ ID NO: 2 claim 18 , or SEQ ID NO: 51.2125-. (canceled)26. The polypeptide of claim 1 , wherein the lectin domain comprises a C-type lectin domain.2731-. (canceled)32. The polypeptide of claim 1 , wherein the trimerization domain is a T4 phage fibritin (foldon) trimerization domain.33. The polypeptide of claim 32 , wherein the trimerization domain comprises SEQ ID NO: 5.3435-. (canceled)36. The polypeptide of claim 1 , wherein the dimerization domain is an immunoglobulin Fc domain.3738-. (canceled)39. The polypeptide of claim 36 , wherein the immunoglobulin Fc domain comprises SEQ ID NO: 6.40. (canceled)41. The polypeptide of claim 1 , wherein the polypeptide comprises SEQ ID NO: 7 claim 1 , SEQ ID NO: 8 claim 1 , SEQ ID NO: 57 claim 1 , or SEQ ID NO: 67.4247-. (canceled)48. A multimeric ...

Подробнее
Номер записи: 90
27-08-2020 дата публикации

Shift Register Unit, Gate Line Driving Circuit and Driving Method Thereof

Номер: US20200273417A1
Автор: Huanyu LI, Jian Zhao, Peng Li
Принадлежит: BOE Technology Group Co Ltd, Hefei Xinsheng Optoelectronics Technology Co Ltd

Disclosed are a shift register unit, a gate driving circuit and a driving method thereof, the shift register unit including: an input sub-circuit configured to provide a trigger signal received by the signal input terminal to the pull-up node; an output sub-circuit configured to output, to the signal output terminal, a pulse signal provided by the first clock signal terminal as a driving signal for scanning a gate line under control of the pull-up node; a reset sub-circuit configured to reset the pull-up node and the signal output terminal under control of the reset terminal; and an input selection sub-circuit configured to select a trigger signal to be provided to the signal input terminal according to voltage levels at first to third control terminals.

Подробнее
Номер записи: 91
27-08-2020 дата публикации

SEMICONDUCTOR DEVICE

Номер: US20200274028A1
Автор: LAI Huan-Yu, Peng Li-Chi
Принадлежит:

A semiconductor device is provided. The semiconductor device includes a first semiconductor layer; a second semiconductor layer on the first semiconductor layer; an active region between the second semiconductor layer and the first semiconductor layer; an electron blocking structure between the active region and the second semiconductor layer; a first In-containing layer between the active region and the electron blocking structure; and a second In-containing layer between the electron blocking structure and the second semiconductor layer; wherein the first In-containing layer and the second In-containing layer each includes indium, aluminum and gallium, the first In-containing layer has a first aluminum content, the second In-containing layer has a second aluminum content, and the second aluminum content is less than the first aluminum content. 1. A semiconductor device , comprising:a first semiconductor layer;a second semiconductor layer on the first semiconductor layer;an active region between the second semiconductor layer and the first semiconductor layer;an electron blocking structure between the active region and the second semiconductor layer;a first In-containing layer between the active region and the electron blocking structure; anda second In-containing layer between the electron blocking structure and the second semiconductor layer; wherein the first In-containing layer and the second In-containing layer each comprises indium, aluminum and gallium, the first In-containing layer has a first aluminum content, the second In-containing layer has a second aluminum content, and the second aluminum content is less than the first aluminum content.2. The semiconductor device according to claim 1 , wherein the first In-containing layer has a first indium content claim 1 , the second In-containing layer has a second indium content claim 1 , and the second indium content is different from the first indium content.3. The semiconductor device according to claim 2 , ...

Подробнее
Номер записи: 92
19-09-2019 дата публикации

Terminal holder and far-field voice interaction system

Номер: US20190287521A1
Автор: Hong Su, Lifeng Zhao, Peng Li
Принадлежит: Baidu Online Network Technology Beijing Co Ltd

Embodiments of the present disclosure disclose a terminal holder and a far-field voice interaction system. A specific implementation of the terminal holder includes: a far-field voice pickup device and a voice analysis device. The far-field voice pickup device receives voice sent by a user, and sends the voice to the voice analysis device. The voice analysis device analyzes the voice, determines whether the voice contains a preset wake-up word, and sends the voice to a terminal in communication connection with the terminal holder when the preset wake-up word is contained. This embodiment receives voice sent by a user through the terminal holder supporting a far-field voice pickup function, thereby facilitating the far-field voice control over the terminal.

Подробнее
Номер записи: 93
19-09-2019 дата публикации

Brightness adjustment device and eye protection lamp

Номер: US20190289695A1
Автор: Jiong Huang, Lele HAN, Peng Li, Wencheng Hu
Принадлежит: BOE Technology Group Co Ltd, Hefei BOE Optoelectronics Technology Co Ltd

A brightness adjustment device and an eye protection lamp are provided. The brightness adjustment device is applied in the eye protection lamp and includes a physical sign detection assembly, configured to obtain heart rate information of a user, and generate and transmit a brightness adjustment signal based on the heart rate information of the user; and a brightness adjustment assembly, connected to the physical sign detection assembly, and configured to adjust brightness of a light emitting device connected to the brightness adjustment assembly based on the brightness adjustment signal.

Подробнее
Номер записи: 94
10-09-2020 дата публикации

ALGEBRAIC DECODING METHOD AND DECODER FOR (N,N(N-1),N-1)-PGC IN COMMUNICATION MODULATION SYSTEM

Номер: US20200287570A1
Автор: Chen Si Jia, DAI BIN, Gao Ya Yu, LIANG Kun, Peng Li, Shi Ying Long, Zhang Lin, ZHOU Bo
Принадлежит: HUAZHONG UNIVERSITY OF SCIENCE AND TECHNOLOGY

The disclosure discloses an algebraic decoding method and a decoder for a (n, n(n−1), n−1) permutation group code in a communication modulation system. The basic principle of the decoding method is: assuming that two code elements p(r)=sand p(r)=scan be correctly detected in a received real vector with a length of n, including their element values s, sand position indices r, rin the vector, an intermediate parameter w is determined by solving an equation (r−r)w=(s−s)(mod n); and each code element is calculated by w according to p(i)=(s+(n−r+i)w)(mod n), i=1, 2, . . . , n. The decoder is mainly composed of multiple n-dimensional registers, a w calculator, n code element calculators, and a code element buffer. In the disclosure, in a case where a receiver only correctly detects two code elements in a transmitted codeword with a length of n, the codeword can be correctly decoded by using the received information of the two code elements. 1. An algebraic decoding method for a (n , n(n−1) , n−1) permutation group code in a communication modulation system , wherein when n is a prime number , the (n , n(n−1) , n−1) permutation group code contains n(n−1) permutation codewords , each of the permutation codewords contains n code elements , and a minimum Hamming distance between any two of the permutation codewords is n−1 , comprising:{'sub': n', '1', '2', '1', '2', '1', '1', '2', '2', '1', '2', 'n', '1', '2', '1', '2', 'n', '1', '2', 'n', 'n', '1', '2, 'i) determining an intermediate parameter w: let w∈Zbe obtained by solving an expression (r−r)w=(s−s)(mod n), wherein (mod n) represents a modulo n operation; let p(r)=sand p(r)=sbe two of the code elements correctly detected in a real signal vector received from a channel, wherein s, s∈Zare respectively element values of the code elements p(r) and p(r), r, r∈Zare respectively position indices of the code elements p(r) and p(r), and Zis a positive integer finite domain represented by Z={1, 2, . . . , n}; and both the code ...

Подробнее
Номер записи: 95
10-09-2020 дата публикации

ENCODING METHOD AND ENCODER FOR (N,N(N-1),N-1) PERMUTATION GROUP CODE IN COMMUNICATION MODULATION SYSTEM

Номер: US20200287774A1
Автор: Chen Si Jia, DAI BIN, Gao Ya Yu, LIANG Kun, Peng Li, QIN Zhen, Shi Ying Long, Zhang Lin, ZHOU Bo
Принадлежит: HUAZHONG UNIVERSITY OF SCIENCE AND TECHNOLOGY

The present disclosure provides an encoding method and an encoder for a (n, n(n−1), n−1) permutation group code in a communication modulation system, in which 2k-length binary information sequences are mapped to 2n-length permutation codeword signal points in a n-dimensional modulation constellation Γ. The constellation Γwith the coset characteristics is formed by selecting 2n-length permutation codewords from n(n−1) permutation codewords of a code set Pof the (n, n(n−1), n−1) permutation group code based on coset partition. The constellation Γis a coset code in which 2cosets are included and each coset includes 2permutation codewords, where k=k+k, and 2≤n(n−1). The present disclosure utilizes the coset characteristics to realize one-to-one correspondence mapping of the binary information sequence set to the permutation code constellation, so that the time complexity of executing the encoder is at most the linear complexity of the code length n. 1. An encoding method for a (n , n(n−1) , n−1) permutation group code in a communication modulation system , wherein the encoding method maps a k-length binary information sequence to a n-length permutation codeword in a signal constellation formed by the (n , n(n−1) , n−1) permutation group code based on coset partition , and comprises following steps of:{'sub': n,x', {'sub2': 'i'}], 'claim-text': [{'br': None, 'i': P', '=C', 'L', '={c', '∘l', '|c', '∈C', ',l', '∈L', ',i∈Z', ',j∈Z, 'sub': n,x', {'sub2': 'i'}, 'n', 'n,x', {'sub2': 'i'}, 'i', 'j', 'i', 'n', 'j', 'n,x', {'sub2': 'i'}, 'n', 'n−1, '}\u2003\u2003(1)'}, {'br': None, 'sub': rn', 'n,x', {'sub2': 'i'}, 'l1', 'n,x', {'sub2': 'i'}], 'sup': n−1', 'n−1, '={(t)L}={(t)L}\u2003\u2003(2)'}], '1) constructing the (n, n(n−1), n−1) permutation group code, wherein when n is a prime number, the (n, n(n−1), n−1) permutation group code contains n(n−1) permutation codewords, each of the n(n−1) permutation codewords contains n code elements, a minimum Hamming distance between any two ...

Подробнее
Номер записи: 96
27-10-2016 дата публикации

Novel methods

Номер: US20160310502A1
Автор: Kimberly Vanover, Lawrence P. Wennogle, Peng Li, Robert Davis, Sharon Mates
Принадлежит: Intra Cellular Therapies Inc

The disclosure provides the use of particular substituted heterocycle fused gamma-carboline compounds as pharmaceuticals for the treatment of residual symptoms of psychosis or schizophrenia. The disclosure also provides novel long acting injectable formulations of particular substituted heterocycle fused gamma-carboline compounds and use of such long acting injectable formulations for the treatment of residual symptoms of psychosis or schizophrenia.

Подробнее
Номер записи: 97
26-09-2019 дата публикации

Process for production of aromatic compounds comprising at least two amine functions

Номер: US20190292128A1
Автор: Armin T. LIEBENS, FENG Shi, Hangkong Yuan, Peng Li
Принадлежит: Lanzhou Institute of Chemical Physics LICP of CAS, Rhodia Operations SAS

Provided is a process for the production of an aromatic compound comprising at least two amine functions, comprising reacting an aromatic compound having at least one hydroxyl function and at least one aldehyde function with a second reactant having an amine function, in the presence of a reductant agent and a catalyst comprising at least one metal element in elemental form and/or at least one metal oxide.

Подробнее
Номер записи: 98
26-09-2019 дата публикации

Substituted heterocycle fused gamma-carbolines synthesis

Номер: US20190292185A1
Автор: Andrew S. Thompson, HUA CHENG, James David Beard, John Charles Tomesch, Lawrence P. Wennogle, Peng Li, Qiang Zhang, WEI Yao
Принадлежит: Intra Cellular Therapies Inc

The present invention provides methods for the preparation of substituted heterocycle fused gamma-carbolines, intermediates useful in producing them and methods for producing such intermediates and such heterocycle fused gamma-carbolines.

Подробнее
Номер записи: 99
03-10-2019 дата публикации

Novel methods

Номер: US20190298730A1
Автор: Kimberly Vanover, Lawrence P. Wennogle, Peng Li, Robert Davis, Sharon Mates
Принадлежит: Intra Cellular Therapies Inc

The disclosure provides the use of particular substituted heterocycle fused gamma-carboline compounds as pharmaceuticals for the treatment of residual symptoms of psychosis or schizophrenia. The disclosure also provides novel long acting injectable formulations of particular substituted heterocycle fused gamma-carboline compounds and use of such long acting injectable formulations for the treatment of residual symptoms of psychosis or schizophrenia.

Подробнее
Номер записи: 100