VACCINES
The invention relates to methods for identifying protective vaccine compositions, as well as to vaccine compositions for use to protect an animal against infection by a Prevalent worldwide, Potency testing of The use of such a large number of animals is ethically and financially undesirable and so an in vitro replacement for the potency test has been sought for some time. Previous attempts have failed due to their reliance on antibodies for characterisation of potency which, being of biological origin, are prone to attenuation. As the majority of this research was unsuccessful, there is a paucity of information in the literature as to the exact approaches employed. However, it is recorded that both the microscopic agglutination test (MAT) and monoclonal antibody based ELISAs were utilised. Further, it was clearly established that protein and LPS, derived from Prior studies [21, 22] have successfully determined the proteome of According to a first aspect of the invention, there is provided a method of identifying a protective For example, this may be determined by exposing the vaccine to a proteolytic enzyme (for example, trypsin or Proteinase K), processing the sample using a mass spectrometry method such as 2D-LC/MS, 1D-LC or gel-MS (for example), determining the Normalised Spectrum Abundance Factor (NSAF, for example determined as described herein) and determining that this is greater than the NSAF obtained from a known non-protective vaccine composition. The term “protective The vaccine composition may comprise an attenuated A non-protective vaccine composition, therefore, is one which does not fulfil the definition of a protective composition given above. The method may comprise determining that the composition comprises a polypeptide comprising SEQ ID NO:13 or an antigenic variant or portion thereof. For example, the method may comprise exposing the composition to a proteolytic enzyme (such as trypsin) and subsequently detecting the presence of a protective concentration or abundance of SEQ ID NO:13 or an antigenic variant or portion thereof. A protective concentration or abundance is a concentration or abundance correlated with vaccine compositions which are known to be protective, as has been shown by the inventors herein. For example, a protective concentration may be at least 0.25 fmol SEQ ID NO:13 polypeptide per μg of vaccine, for example at least 0.5 fmol SEQ ID NO:13 polypeptide per μg of vaccine. The vaccine may first have been exposed to a proteolytic enzyme (such as trypsin or Proteinase K), generating a pool of tryptic peptides in which SEQ ID NO:13 may be included. The term “Lipl32 epitope polypeptide”, as used throughout this specification, indicates a peptide which contains one or more (or all) epitopes of Lipl32 protein and, furthermore, comprises SEQ ID NO:13 or an antigenic variant or portion thereof. Therefore, a Lipl32 epitope polypeptide may be a polypeptide comprising Lipl32 full length polypeptide (for example, SEQ ID NO:1) or a fragment thereof having up to 250 amino acids which contains at least one Lipl32 epitope. The Lipl32 epitope polypeptide may be Lipl32 (SEQ ID NO:1) or a functional fragment thereof, such as SEQ ID NO:13. SEQ ID NO:1 is the sequence of Lipl32 from An “antigenic variant or portion” of SEQ ID NO:13, as referred to throughout this specification, is any sequence having equivalent antigenic properties as SEQ ID NO:13. For example, this would include a sequence which is capable of binding with an antibody which is itself capable of binding with the polypeptide having amino acid sequence SEQ ID NO:13. Advantageously, the use of the method according to the invention enables the user to verify whether a new vaccine composition will be potent, i.e., whether administration of the vaccine to an animal will protect the animal from infection, without the need for animal testing verification such as is currently used. The user simply needs to determine the concentration (i.e., abundance) of the Lipl32 epitope polypeptide within the composition so as to confirm whether the composition is a potent vaccine, i.e., will provide protection from infection to an animal to which it is administered. When the Lipl32 epitope polypeptide is present at a protective concentration or abundance, the Normalised Spectrum Abundance Factor (NSAF, determined after exposure of the vaccine to a tryptic peptide and processing by mass spectrometry such as by 2D-LC/MS, for example as described herein) of the polypeptide may be shown to be between about 1.2-fold and 1.8-fold, for example at least about 1.2-, 1.3-, 1.4-, or 1.5-fold greater than the equivalent factor in a known non-potent (i.e., non-protective) reference vaccine, for example at least about 1.25-, 1.26-, 1.27-, 1.28, 1.29-, 1.30-, 1.35-, 1.30-, 1.41-, 1.42-, 1.43-, 1.44-, 1.45-, 1.46-, 1.47-, 1.48- or about 1.49-fold greater. According to a second aspect of the invention, there is provided a Lipl32 polypeptide having the amino acid sequence SEQ ID NO:13, or an antigenic variant or portion thereof. A third aspect of the invention provides a nucleic acid encoding the polypeptide according to the second aspect of the invention, for example a nucleic acid having nucleotide sequence SEQ ID NO:45, or a complement thereof. Alternative functional variant nucleic acid sequences, related to SEQ ID NO:45 by degeneracy of the genetic code and still encoding SEQ ID NO:13, will be readily derivable by the skilled person. The polypeptide and/or nucleic acid may be isolated. According to a fourth aspect of the invention, there is provided a vaccine composition comprising a Lipl32 epitope polypeptide having up to 250 amino acids and comprising a polypeptide according to the second aspect of the invention. The Lipl32 epitope polypeptide may, for example, have up to about 225, 200, 175, 150, 125, 100, 90, 80, 70, 60, 50, 40, 30 or up to about 20 amino acids. A protective concentration is a concentration correlated with vaccine compositions which are known to be protective, for example, giving a NSAF which is between 1.2- to 1.5-fold greater (e.g., about 1.27- or 1.49-fold greater) than in a known non-potent vaccine, as outlined above. A full-length Lipl32 epitope polypeptide, for example SEQ ID NO:1 from The vaccine composition may be for use in a method of protecting an animal from infection by a bacterium of genus According to a fifth aspect of the invention, there is provided a method of identifying an immunogenic element in a vaccine composition comprising submitting the composition to a two-dimensional liquid chromatography mass spectrometry (2D LC/MS) process. The term “immunogenic element” indicates a polypeptide, protein or other compound which initiates an immune response in an animal or a cell exposed to the vaccine composition. Such an immune response may be assessed, for example, by detection of increased antibody expression and/or by a cell mediated immunity (CMI) assay. The method may comprise the steps of
The method may further comprise an initial step of exposing the vaccine to a proteolytic enzyme to yield peptides for separation and sequencing, prior to passing the composition through the SCX column. Alternatively or additionally, the method may further comprise comparing the mass spectrum output from (c) to mass spectra information from a library of polypeptides and identifying a polypeptide in the library having a corresponding mass spectrum. Alternatively or additionally, the method may also further comprise a subsequent step of quantitation of target protein based on either peptides or intact protein using calibration curves prepared from synthetic peptides or proteins. In a further alternative or additional embodiment, the method may further comprise subsequently obtaining a sample of the identified polypeptide and testing it for immunogenic properties. For example, once a polypeptide has been identified in the library it can readily be prepared by recombinant or other means by the skilled person, without use of inventive skill. The polypeptide can then be used, directly or as part of a vaccine composition, in an animal model to test for immunogenic properties, for example in a humoral cell response assay or a cell-mediated immunity assay, to determine whether the polypeptide induces an immune response. Methods such as those set out in Marbehant in The present invention encompasses the polypeptides SEQ ID NOs:13-44 and functional variants thereof. In particular, it encompasses functional (or “antigenic”) variants of SEQ ID NO:13 and methods utilising these variant polypeptides. As used herein, a “variant” means a polypeptide in which the amino acid sequence differs from the base sequence from which it is derived in that one or more amino acids within the sequence are deleted or substituted with other amino acids. The variant is a functional variant, in that the functional characteristics of the polypeptide from which the variant is derived are maintained. For example, a similar immune response is elicited by exposure of an animal, or a sample from an animal, to the variant polypeptide, compared to the response elicited by exposure to the non-variant peptide. For example, an antibody which is known to be capable of binding to SEQ ID NO:13 will also be capable of binding to the variant polypeptide. In particular, any amino acid substitutions, additions or deletions must not alter or significantly alter the tertiary structure of one or more epitopes contained within the polypeptide from which the variant is derived, so that binding can still occur to an antibody known to be capable of binding to SEQ ID NO:13. The skilled person is readily able to determine appropriate functional variants and to determine the tertiary structure of an epitope and any alterations thereof, without the application of inventive skill. Amino acid substitutions may be regarded as “conservative” where an amino acid is replaced with a different amino acid with broadly similar properties. Non-conservative substitutions are where amino acids are replaced with amino acids of a different type. By “conservative substitution” is meant the substitution of an amino acid by another amino acid of the same class, in which the classes are defined as follows: As mentioned above, non-conservative substitutions are possible provided that these do not disrupt the tertiary structure of an epitope within the polypeptide, for example, which do not interrupt the immunogenicity (for example, the antigenicity) of the peptide. Broadly speaking, fewer non-conservative substitutions will be possible without altering the biological activity of the polypeptide. Suitably, variants may be at least about 65% identical, about 70% identical, for example at least about 75% identical, such as at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or about 99% identical to the non-variant base sequence. Sequence identity between amino acid sequences can be determined by comparing an alignment of the sequences. When an equivalent position in the compared sequences is occupied by the same amino acid, then the molecules are identical at that position. Scoring an alignment as a percentage of identity is a function of the number of identical amino acids at positions shared by the compared sequences. When comparing sequences, optimal alignments may require gaps to be introduced into one or more of the sequences to take into consideration possible insertions and deletions in the sequences. Sequence comparison methods may employ gap penalties so that, for the same number of identical molecules in sequences being compared, a sequence alignment with as few gaps as possible, reflecting higher relatedness between the two compared sequences, will achieve a higher score than one with many gaps. Calculation of maximum percent identity involves the production of an optimal alignment, taking into consideration gap penalties. The percentage sequence identity may be determined using BLAST sequence alignment software, publicly available via http://blast.ncbi.nlm.nih.gov/Blast.cgi (accessed on 13 Sep. 2010 and 13 Sep. 2011), using default parameter settings. Comparison should be determined for the full length sequence of the polypeptide, to avoid high sequence identity over a short fragment of the polypeptide. A functional fragment of the polypeptide is a fragment wherein the functional characteristics of the polypeptide from which the fragment is derived are maintained, as described above. A functional fragment of SEQ ID NO:1 may comprise at least, for example, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 contiguous amino acids from within the sequence SEQ ID NO:l. For example, a functional fragment may comprise SEQ ID NO:13. Using the standard genetic code, nucleic acids encoding the polypeptides may readily be conceived and manufactured by the skilled person. The nucleic acid may be DNA or RNA and, where it is a DNA molecule, it may for example comprise a cDNA or genomic DNA. The invention encompasses nucleic acids (e.g., SEQ ID NO:45) encoding the polypeptide of the invention and variants thereof. The term “variant” or “functional variant” in relation to a nucleic acid sequences means any substitution of, variation of, modification of, replacement of deletion of, or addition of one or more nucleic acid(s) from or to a polynucleotide sequence providing the resultant polypeptide sequence encoded by the polynucleotide exhibits at least the same properties as the polypeptide encoded by the basic sequence. The term therefore includes allelic variants and also includes a polynucleotide (such as a complementary polynucleotide) which substantially hybridises to the polynucleotide sequence of the present invention. Such hybridisation may occur at or between low and high stringency conditions. In general terms, low stringency conditions can be defined a hybridisation in which the washing step takes place in a 0.330-0.825 M NaCl buffer solution at a temperature of about 40-48° C. below the calculated or actual melting temperature (Tm) of the probe sequence (for example, about ambient laboratory temperature to about 55° C.), while high stringency conditions involve a wash in a 0.0165-0.0330 M NaCl buffer solution at a temperature of about 5-10° C. below the calculated or actual Tm of the probe (for example, about 65° C.). The buffer solution may, for example, be SSC buffer (0.15M NaCl and 0.015M tri-sodium citrate), with the low stringency wash taking place in 3×SSC buffer and the high stringency wash taking place in 0.1×SSC buffer. Steps involved in hybridisation of nucleic acid sequences have been described for example in Sambrook et al. (1989; Molecular Cloning, Cold Spring Harbor Laboratory Press, Cold Spring Harbor). Variant nucleic acids of the invention may be codon-optimised for expression in a particular host cell. Polypeptides and nucleic acids of the invention may be prepared synthetically using conventional synthesisers. Alternatively, they may be produced using recombinant DNA technology and may be incorporated into suitable expression vector, which is then used to transform a suitable host cell, such as a prokaryotic cell such as Throughout the description and claims of this specification, the words “comprise” and “contain” and variations of the words, for example “comprising” and “comprises”, mean “including but not limited to” and do not exclude other moieties, additives, components, integers or steps. Throughout the description and claims of this specification, the singular encompasses the plural unless the context otherwise requires. In particular, where the indefinite article is used, the specification is to be understood as contemplating plurality as well as singularity, unless the context requires otherwise. Preferred features of each aspect of the invention may be as described in connection with any of the other aspects. Other features of the present invention will become apparent from the following examples. Generally speaking, the invention extends to any novel one, or any novel combination, of the features disclosed in this specification (including the accompanying claims and drawings). Thus, features, integers, characteristics, compounds or chemical moieties described in conjunction with a particular aspect, embodiment or example of the invention are to be understood to be applicable to any other aspect, embodiment or example described herein, unless incompatible therewith. Moreover, unless stated otherwise, any feature disclosed herein may be replaced by an alternative feature serving the same or a similar purpose. Embodiments of the invention will now be described, by way of example only, with reference to the following Methods Culture of Starter cultures were prepared by inoculation of 20 ml EMJH (Becton Dickinson, USA) media with 1 ml Extraction of Bacterial cell pellets were suspended in PBS (10 ml) containing PMSF (100 μM) and lysed by 6 second pulses of probe sonication (amplitude 60) using a Vibra-Cell ultrasonic processor (Sonics and Materials, USA) for 3 minutes on ice. Cell debris was removed by centrifugation at 300×g and the supernatant retained. A low speed cytosolic extract was produced from the supernatant by centrifugation at 32000×g for 30 minutes. The pellet was retained and the supernatant (cytosol extract) was then desalted by dilution with ammonium bicarbonate (2.5 mM; pH 8.0), concentrated to 0.5 ml by centrifugation in 5 kDa molecular weight cut off concentrators (Sartorius Stedim, France) and stored at −20° C. The retained pellet was then washed by suspension in chilled phosphate buffered saline (PBS; 200 mM, pH 7.2) and collected by centrifugation (32000×g). The washed pellet was re-suspended in 3 ml lysis buffer (Urea 5 M, Thiourea 2 M, DTT 100 mM, CHAPS 2%, 3-(Decyldimethylammonio)propanesulfonate inner salt 2%, Pharmalytes 3-10 0.5%, Tris Base 0.48%) and centrifuged at 32000×g for 30 minutes. The insoluble protein fraction was precipitated in a 4-fold excess of ice cold acetone and incubated at −20° C. for 48 hours prior to centrifugation (3000×g for 30 minutes). The resulting pellet (insoluble fraction) was desalted and concentrated as before using ammonium bicarbonate and Vivaspin centrifugal filters respectively. Estimation of protein concentration for both fractions was then determined using the Bradford method (Sigma-Aldrich, UK), with bovine serum albumin as the calibration standard (0.05-1.0 mg/ml). Vaccine Selection and Preparation Bivalent vaccines, giving protection against The vaccines were concentrated using 5 kDa molecular weight cut off concentrators, washed once with 2.5 mM Ammonium Bicarbonate and then concentrated again to a final volume of 0.5 ml. Estimation of protein in the vaccines was determined using the Bradford method with bovine serum albumin as the standard. Estimation of LPS in the vaccines was determined using an Endochrome K kit (Charles River, UK) which is based on the Limulus Amebocyte Lysate (LAL) assay. Gel Electrophoresis The protein and LPS content of the vaccines was determined by SDS-PAGE was conducted on the X cell surelock system (Invitrogen) using a 4-12% gradient NuPAGE gel at 150 W. Gels contained a 3.5 kDa protein ladder, two concentrations of LPS (Sigma) and aliquots (36 μl) of untreated vaccine (n=4); vaccine C was loaded at a lower volume (10 μl) due to its high protein content, larger volumes resulted in overloading of the gel. LPS was visualised in the gel using a silver staining method [13, 30]; protein was visualised in an identical second gel using EZ run Coomassie stain (Fisher). In gel trypsin digestion was carried out according to the method described by Weeks; mass analysis was performed as described previously on an Agilent 6520 Q-TOF using an acetonitrile gradient of 0% to 81% [v/v] over 21 minutes. Strong Cation Exchange (SCX) Chromatography Three aliquots of each bacterial fraction and vaccine, normalised to 100 μg, were heat denatured at 95° C. for 5 minutes and then digested overnight with 2 μg sequencing grade trypsin (Promega). Digestion was terminated by the addition of 1 μl of 25.2M formic acid (Fluka). Due to the low concentration of protein found in vaccine B ( Tryptic digests were centrifuged (5000×g for 1 minute) to remove cellular debris and the supernatant sampled to 250 μl HPLC vial inserts. Tryptic peptides (50 μl of digest) were chromatographed using a Hewlett-Packard 1100 system on a Biobasic SCX HPLC (2.1×100 mm) column (Thermo Scientific). Analytes were eluted at a flow rate of 0.25 ml/min with mobile phases comprising 75:25 2.5 mM ammonium acetate:acetonitrile pH 4.5 (A) and 75:25 250 mM ammonium acetate: acetonitrile pH 4.5 (B) and a binary gradient (t=0 min, A 100%; t=5 min, A 100%; t=18 min, 65% A; t=20 min, B 100%; t=22 min, A 100%; t=32 min, A 100%). The optical density of HPLC effluent was recorded at 280 nm and 15 fractions of 1 ml duration were collected between 8 and 23 min. The SCX fractions were taken to dryness at 60° C. using a centrifugal concentrator (Eppendorf 5301). Reverse Phase Chromatography and Mass Analysis Dried SCX fractions were dissolved in 0.1% v/v formic acid (20 μl) and analyzed on an Agilent 6520 Q-TOF mass spectrometer (Agilent Technologies) with an HPLC chip cube source. The chip consisted of a 40-nl enrichment column (Zorbax 300SB-C18 5 μm) and a 75 μm×150 mm separation column (Zorbax 300SB-C18 5 μm) driven by the Agilent Technologies 1200 series nano/capillary liquid chromatography system. Both systems were controlled by Masshunter Workstation Data Acquisition for Q-TOF (Version B.02.00, Patches 1,2; Agilent Technologies). Peptides were resuspended in 0.1% TFA with the chip switched to enrichment and using the capillary pump. After the sample volume (1 μl) passed through the enrichment column once, the chip was then switched to separation and peptides were eluted from the enrichment column and run through the separation column during a 47 minute gradient (4.5% to 72% [v/v] acetonitrile) directly into the mass spectrometer. The mass spectrometer was run in positive ion mode, with MS scans run over a range of m/z 100 to 3000 and at one spectra per second. Precursor ions were selected for auto MS/MS at an absolute threshold of 2000 and a relative threshold of 0.01, with a maximum of 5 precursors per cycle, active exclusion being set at 1 spectra and released after 3 minutes. Precursor charge-state selection and preference were set to 2+ and then 3+ and precursors were selected by abundance. Bioinformatics Spectrum Mill (Agilent, UK) and OMSSA (NCBI, USA) were used to extract MS/MS data from Masshunter acquisition files and proteins were subsequently identified by comparison of tryptic peptide product ion mass spectra against a protein database. Search parameters included selection of trypsin with up to two missed cleavage sites and a variable modification for oxidation of methionine residues. Identified proteins were exported as tab separated files for bioinformatics analysis. A protein database was used to determine optimal identification, these included the NCBI non-redundant (nr) database (ftp://ftp.ncbi.nlm.nih.gov/blast/db/FASTA accessed on 12 Jun. 2010 and 13 Sep. 2011), the uniprot sprot fasta database (ftp://ftp.uniprot.org/pub/databases/uniprot/knowledgebase accessed on 12 Jun. 2010 and 13 Sep. 2011) and a custom made database derived from chromosomes I and II of The false discovery rate (FDR) was calculated by searching the three replicates of vaccine A against reverse and forward-reverse decoy databases, created from the The relative abundance of proteins present in all three technical repeats was determined through spectral counting. With the normalised spectrum abundance factor (NSAF) used to account for differences in peptide length, allowing for accurate comparison of coverage between individual vaccines. The normalised spectrum abundance factor (NSAF), calculated as described by Zybailov et al., was used to account for differences in peptide length, allowing for comparison of coverage between individual vaccines, using a novel program developed at the Animal Health and Veterinary Laboratories Agency. Assessment of Performance To ensure accuracy and reproducibility of chromatographic separations, performance was monitored by the analysis of specific standards prior to each run. SCX was monitored by using tryptically digested BSA (25 μg/ml) and two blanks to control for sample carryover. RP-HPLC and subsequent mass spectrometry was assessed by monitoring the retention time and intensity of ions derived from a synthetic peptide mix (10 ng/ml) containing the polypeptides: Lipl32 Quantitation Synthetic peptide analogues, corresponding to N and C terminal region tryptic peptides found in Lipl32 (see below and Table 5), were obtained (Peptides Synthetics, UK) for detection and quantification using multiple reaction monitoring (Table 1). Optimal transitions and conditions for the peptides of interest (Table 1) were obtained using the MS and MS/MS data from previous Q-Tof analysis of vaccine C. The acquired data was quantified using the Agilent Masshunter Quantitative Analysis software (Version B.03.01; Agilent Technologies). Results Protein Identification Initial analysis of vaccines using 2D-LC/MS revealed a high level of albumin, when searched against the NCBI non-redundant database, which could mask the presence of low abundant proteins. A number of different approaches were attempted to minimise albumin identification including filter aided washing during sample preparation and the use of an albumin exclusion list. It was found that washing the sample once improved identification of lower abundant proteins dramatically, additional washes were attempted but these led to a reduction in overall proteins identified; the use of an albumin exclusion list had no effect, most likely due to factors such as the length of the exclusion list and the speed of the instrument. The amount of protein present in 1 ml single dose aliquots (as sold) of vaccine is shown in Table 2 and good correlation was observed with the SDS gels in No protein was observed in vaccine B. However, when separated via strong cation exchange chromatography ( The chromatograms for vaccines A and C-E show fairly similar profiles with an intense peak at ˜14 minutes appearing in each, this is most likely the active element(s) of the vaccines. Further Characterisation Reveals some Vaccines to be Free from LPS Gram negative bacteria such as Gel electrophoresis ( Analysis of Vaccine Proteomes allows for Identification of Conserved Proteins Identification of vaccine proteins required that mass data be interrogated against a database using a suitable search program. For the purposes of this study Spectrum Mill and OMSSA were chosen, mass spectra was analysed using equivalent conditions. Proteins which were common to each vaccine, across all three technical repeats, were then determined using Microsoft Access and their respective abundances calculated using the normalised spectrum abundance factor (Table 3A). This showed that Lipl32 was present in all vaccines. Table 3B shows an optimised analysis of the results, which also showed that Flagellin protein was present in all vaccines. The number of proteins identified using OMMSA was substantially higher in vaccines C-E than the number identified using Spectrum Mill, which is consistent with the false discovery rates calculated for the two programs; it was therefore decided that the results gained through Spectrum Mill were more reliable and this was used in subsequent analyses. Two batches of a vaccine, one which had passed the in vivo potency test (a) and another which had failed (β), were subsequently analysed using 2D-LC/MS (Table 4A; accession numbers are NCBI GI numbers). Lipl32, which had previously been identified as being present in vaccines A-E (Tables 2A & 2B), is shown to be present at a higher abundance (p<0.01) in the passed batch (a) compared to the failed batch (β), with an NSAF 1.49-fold higher. Table 4B shows the results after an optimised analysis, in which Lipl32 was again shown to be present at a higher abundance (p≦0.05) in the passed batch, with an NSAF 1.27-fold higher. Spectrum Mill was subsequently used to identify which Lipl32 peptides following digestion with trypsin (i.e., tryptic peptides) were present in the two batches, allowing comparison with those found in Quantitation of Lipl32 in Passed and Failed Batches of Vaccine To enable accurate determination of the concentration of Lipl32 in the vaccines, two tryptic peptides from Table 5 (SEQ IS NOs:13 & 14), corresponding to regions in the N and C termini of the protein, were selected for quantitation using multiple reaction monitoring (MRM). The limit of detection (LoD) of the N and C termini region peptides was determined as 0.025 and 0.018 fmol/μg respectively, using the empirical method: where LoB=meanblank+1.645(SDblank) The limit of quantification (LOQ), defined as the lowest concentration of the standard with a coefficient of variation lower than 20%, was 0.02 and 0.05 fmol/μg for the N and C termini region peptides. Calibration curves for both peptides were constructed using Masshunter software (Agilent, UK) over the tested concentration range (0.01-100 fmol/μg) allowing determination of sample concentration ( Discussion Given that vaccines A, B, D and E were derived from inactivated forms of the same bacteria, proteomic analysis reveals an unexpected heterogeneity of components. This, together with an absence of detectable LPS in vaccines C and D, suggests stark contrasts in the purification methods employed during manufacture. It seems improbable that the constituent responsible for protective immunity would be different in each vaccine and, since these vaccines are all known to be equally efficacious, the inventors concluded that they must share some common immunogenic element. The absence of detectable LPS in vaccine C rules it out as a potential target molecule for an in vitro vaccine potency test. The proteomes of the five vaccines were, therefore, compared against one another. Comparison of the vaccines which showed a positive reaction to the protein assay (i.e. A and C-E) revealed five conserved proteins. Of these it was the flagellin and lipoproteins that were of interest, as both are known to be potential immunogens[14, 31]. When vaccine B was included in the comparison, the only proteins identified as being conserved were flagellin and Lipl32, which is noteworthy as they were also found in a high abundance in the bacteria itself. Lipl32, also known as hemolysis associated protein-1 (Hap-1), is a major surface expressed outer membrane protein found in pathogenic Initial analysis of passed and failed batches of vaccine using spectral counting (NSAF) estimated that Lipl32 was present at a statistically (p≦0.05) higher abundance in passed vaccines compared to failed indicating that it would make a good target molecule for an in vitro potency test. To corroborate this, multiple reaction monitoring (MRM) was used to accurately quantitate the concentration of Lipl32 in passed (n=2) and failed (n=2) batches of vaccine C. MRM quantitates proteins based on specific peptide sequences; to ensure good coverage of Lipl32 two peptide sequences, corresponding to start (N terminus) and end (C terminus) regions of the protein, were selected for quantitation. The concentration of the C terminus peptide was approximately the same across both conditions ( In conclusion, the inventors have shown 2D-LC/MS to be an effective tool for vaccine analysis and has identified a target protein, Lipl32, upon which to base an in vitro potency test, in which the NSAF is significantly higher in potent vaccines than in non-potent vaccines. N terminal amino acid quantitation of Lipl32 has been shown to be a highly quantitative, novel assay for the determination of potency in vitro. There is provided a method of identifying a protective 1. A method of identifying a protective 2. The method of 3. The method of 4. The method of 5. The method of 6. The method of 7. The method of 8. The method of 9. The method of 10. The method of 11. A Lipl32 epitope polypeptide having the sequence SEQ ID NO:13, or an antigenic variant or portion thereof. 12. A nucleic acid encoding the polypeptide of 13. A vaccine composition comprising a polypeptide having up to 250 amino acids and comprising a polypeptide according to 14. A vaccine composition comprising a nucleic acid of 15. The vaccine composition of 16. (canceled) 17. The vaccine composition of 18. The vaccine composition of 19. The vaccine composition of 20. A method of identifying an immunogenic element in a vaccine composition comprising submitting the composition to a two-dimensional liquid chromatography mass spectrometry (2D LC/MS) process. 21. The method of a. passing the vaccine composition through a strong cation exchange (SCX) column and recovering elute from the column; b. passing the elute from step (a) through an analytical reverse phase column and recovering elute from the column; and c. passing the elute from step (b) into a mass spectrometer and recording the output. 22. The method of 23. The method of 24. The method of 25. The method of FIELD OF INVENTION
BACKGROUND
SUMMARY OF INVENTION
Nonpolar: Ala, Val, Leu, Ile, Pro, Met, Phe, Trp Uncharged polar: Gly, Ser, Thr, Cys, Tyr, Asn, Gln Acidic: Asp, Glu Basic: Lys, Arg, His
As is well known to those skilled in the art, altering the primary structure of a polypeptide by a conservative substitution may not significantly alter the activity of that polypeptide because the side-chain of the amino acid which is inserted into the sequence may be able to form similar bonds and contacts as the side chain of the amino acid which has been substituted out. This is so even when the substitution is in a region which is critical in determining the peptide's conformation.
BRIEF DESCRIPTION OF FIGURES
EXAMPLES
(SEQ ID NO: 2) MRFA (SEQ ID NO: 3) AVDQLNEQSSEPNIYR (SEQ ID NO: 4) ARPQELPFLASIQNQGR (SEQ ID NO: 5) NYINQYSEVAIQMVMHMQPK (SEQ ID NO: 6) ISVNNVLPVDFNLMQQK (SEQ ID NO: 7) VTALYEGFTVQNEANK Tryptic peptides and product ions selected for detection and quantification by MS using multiple selection reaction monitoring. Precursor Product Retention Molecular ion for MRM ion for MRM Time Peptide Sequence Terminus Mass (Da) (m/z) (m/z) (min) SSFVLSEDTIPGTNETVK N 1924.07 962.50 845.40 13.16 (SEQ ID NO: 13) ISFTTYKPGEVK C 1369.56 457.30 628.80 10.80 (SEQ ID NO: 14)
Passed (n=2) and failed (n=2) batches of vaccine C were prepared, quantitated and digested as described above. SCX separation was performed generally as described above, with some changes. The 15 fractions of each replicate were recombined prior to being taken to dryness, redissolved in 0.1% v/v formic acid (50 μl) and analyzed on an Agilent 6410 Triple Quadrupole mass spectrometer (Agilent Technologies) with an HPLC chip cube source. The chromatography chip consisted of a 160-nl enrichment column (Zorbax 300 SB-C18 5 μm) and a 75 μm×150 mm analytical column (Zorbax 300 SB-C18 5 μm) driven by the Agilent Technologies 1200 series nano/capillary liquid chromatography system. Both systems were controlled by Masshunter Workstation Data Acquisition for Triple Quadrupole (Version B.02.01; Agilent Technologies). Tryptic peptides (1 μl) were loaded onto the enrichment column of the chip and washed eight times with 0.1% TFA. Peptides were then separated on the analytical column using an acetonitrile gradient (4.5% to 90% [v/v]) over 25 minutes and eluted directly into the mass spectrometer. The mass spectrometer was run in positive ion mode, with the electrospray voltage set to 1900V and gas temperature and pressure set at 300° C. and 4 l/min respectively.
Concentration of protein in Vaccines A-E (as sold) as determined by the Bradford assay Concentration (mg; mean ± 1 SD) Vaccine N Protein A 2 1.47 ± 0.27 B 2 0.07 ± 0.01 C 2 11.94 ± 1.57 D 2 6.38 ± 0.44 E 2 2.41 ± 0.06 Showing conserved proteins present in commercially available vaccines from five different manufacturers (A-E). Higher ln(NSAF) values indicate greater abundance. Accession Mean ln(NSAF) Number Gene Name A* A† B* B† C* C† D* D† E* E† 45658793 LipL41 −2.85 −3.46 ND ND −2.19 −2.95 −2.03 −3.12 −2.23 −3.92 (SEQ ID NO: 8) 45657753 Flagellin Protein −3.2 −2.63 ND ND −3 −3.19 −2.21 −3.14 −2.54 −3.52 (SEQ ID NO: 9) 45657230 LipL32 −3.45 ND −2.19 ND −2.37 ND −2.16 ND −2.77 ND (SEQ ID NO: 1) 45656175 Cell Wall −3.58 ND ND ND −2.29 ND −2.23 ND −2.89 ND Hydrolase (SEQ ID NO: 10) 45656311 Hypothetical Protein −4.15 ND ND ND −3.01 ND −2.81 ND −2.78 ND LIC10411 (SEQ ID NO: 11) 45656623 Hypothetical Protein ND −3.03 ND ND ND −1.67 ND −0.89 ND −1.61 LIC10725 (SEQ ID NO: 12) Mean Total Proteins ± 1 SD 86 ± 21 85 ± 20 8 ± 8 6 ± 8 31 ± 4 82 ± 14 19 ± 4 44 ± 14 30 ± 13 50 ± 7 *= Data obtained through searching spectra using Spectrum Mill †= Data obtained through searching spectra using OMSSA ND = Protein not detected using this program Conserved proteins present in commercially available vaccines from five different manufacturers (A-E). Higher ln(NSAF) values indicate greater abundance. Accession Mean ln(NSAF) Number Gene Name A B C D E 45657230 LipL32 −4.11 −2.64 −2.48 −2.22 −2.88 45657753 Flagellin Protein −3.41 −2.44 −3.01 −2.35 −2.59 45658793 LipL41 −3.35 ND −2.09 −2.08 −2.39 45656311 Hypothetical −2.45 ND −3.13 −2.96 −3.03 Protein LIC10411 Mean Proteins ± 1 SD 221 ± 31 9 ± 8 34 ± 4 21 ± 5 34 ± 17 ND = Protein not detected using this program Showing conserved proteins present in two different batches of the same vaccine, the first (α) passed an in vivo potency test whereas the second (β) failed. Mean Accession ln(NSAF) Number Gene Name α β P value 45657309 Histidine Kinase Sensor Protein −4.71 −4.37 5.45E−3 45657230 LipL32 −2.78 −3.18 8.13E−3 45657022 Hypothetical Protein LIC11138 −4.96 −4.39 9.22E−2 45658246 Isoleucyl-tRNA Synthetase −4.52 −3.81 1.15E−1 45658793 LipL41 −2.48 −2.26 2.01E−1 45655648 Acyl Carrier Protein −2.59 −2.25 2.26E−1 45656175 Cell Wall Hydrolase −1.85 −1.69 3.14E−1 45658886 LipL36 −4.65 −4.31 4.02E−1 45657930 Cysteine Synthase −4.11 −4.37 4.14E−1 45657213 Chaperonin GroEL −3.18 −3.29 4.50E−1 45657748 Putative Lipoprotein −3.80 −4.06 4.93E−1 45657753 Flagellin Protein −3.65 −3.91 5.10E−1 45656611 Putative Lipoprotein −3.72 −3.59 5.69E−1 45658988 Hypothetical Protein LIC13166 −3.49 −3.63 6.12E−1 45657078 Putative Citrate Lyase −4.01 −3.97 9.12E−1 Mean Total Proteins ± 1 SD 42 ± 2 34 ± 2 Showing conserved proteins present in two different batches of the same vaccine, the first passed an in vivo potency test whereas the second failed. Accession Mean ln(NSAF) Number Gene Name Passed Failed P Value 45657309 Histidine Kinase Sensor Protein −4.92 −4.57 9.23E−03 45657230 LipL32 −2.83 −3.07 3.20E−02 45658246 Isoleucyl-tRNA Synthetase −4.46 −3.89 8.58E−02 45658988 Hypothetical Protein LIC13166 −3.54 −3.7 9.39E−02 45656611 Putative Lipoprotein −3.94 −3.63 1.05E−01 45657748 Putative Lipoprotein −3.78 −4.27 1.70E−01 45658793 LipL41 −2.65 −2.44 1.90E−01 45656945 Cell Division Protein −5.68 −5.24 2.04E−01 45657213 Chaperonin GroEL −3.22 −3.35 3.63E−01 45655648 Acyl Carrier Protein −2.71 −2.36 3.65E−01 45658886 LipL36 −4.86 −4.51 3.76E−01 45657869 ATP-dependent Protease −4.58 −4.73 3.83E−01 45657930 Cysteine Synthase −4.33 −4.58 4.10E−01 45657753 Flagellin Protein −3.79 −4.12 4.66E−01 45656175 Cell Wall Hydrolase −1.97 −1.88 5.42E−01 45657078 Putative Citrate Lyase −3.95 −3.91 8.55E−01 Mean Total Proteins ± 1 SD 54 ± 8 42 ± 4 Comparison of tryptic peptides present in an in silico digest of Lipl32 against Lipl32 tryptic peptides identified in SEQ ID Passed Failed NO. in silico Digest Vaccine Vaccine 15 AYYLYVWIPAVIAEMGVR + − − 16 IPNPPK + − − 17 LDDDDDGDDTYK + − − 18 SMPHWFDTWIR + + + 13 SSFVLSEDTIPGTNETVK + + − 19 IKIPNPPK + − − 14 ISFTTYKPGEVK + − + 20 MISPTGEIGEPGDGDLVSDAFK + − − 21 MSAIMPDQIAK + + + 22 AAKAKPVQK − − − 23 AATPEEKSMPHWFDTWIR − − − 24 AKPVQKLDDDDDGDDTYK − − − 25 EERHNK − − − 26 GSFVASVGLLFPPGIPGVSPLIHSNPEELQK − − − 27 IPNPPKSFDDLK − − − 28 KAYYLYVWIPAVIAEMGVR − − − 29 KLSILAISVALFASITACGAFGGLPSLK − − − 30 LDDDDDGDDTYKEER − − − 31 LLVRGLYR − − − 32 LSILAISVALFASITACGAFGGLPSLK − − − 33 QAIAAEESLK − − − 34 QAIAAEESLKK − − − 35 SFDDLKNIDTK − − − 36 SMPHWFDTWIRVER − − − 37 TLLPYGSVINYYGYVKPGQAPDGLVDGNK − − − 38 TLLPYGSVINYYGYVKPGQAPDGLVDGNKK − − − 39 YNSLTRIK − − − 40 GLYRISFTTYKPGEVK − − − 41 HNKYNSLTR − − − 42 MISPTGEIGEPGDGDLVSDAFKAATPEEK − − − 43 MSAIMPDQIAKAAK − − − 44 VERMSAIMPDQIAK − − − REFERENCES



