HYPOALLERGENIC HYBRID POLYPEPTIDES FOR THE TREATMENT OF ALLERGY
More than 10% of the world population suffer from allergy to grass pollen. Here we describe the development of a vaccine based on recombinant hypoallergenic hybrid molecules which were constructed out of elements derived from the four major timothy grass pollen allergens Phl p 1, Phl p 2, Phl p 5, and Phl p 6 for the treatment of grass pollen allergy. Codon-optimized synthetic genes encoding building blocks and combinations of the four allergens were designed according to epitope mapping studies and structural data and subsequently expressed in IgE-mediated allergies represent a worldwide health problem with increasing prevalence (1). The hallmark of allergic disease is the production of IgE antibodies specific for environmental allergens, mainly from pollen, mites, animal dander, and moulds (1). Allergic symptoms occur, when receptor-bound IgE on mast cells or basophils is cross-linked by multivalent allergen, leading to the release of inflammatory mediators (2). In addition, IgE-facilitated presentation via FcεRI and FcεRII on antigen presenting cells strongly enhances the activation of allergen-specific T cells contributing to T cell mediated allergic inflammation (3, 4). Allergen-specific immunotherapy currently represents the only causative treatment of allergies with a long-term effect, although its success is impaired by the use of crude allergen extracts (5, 6). These preparations contain allergenic and non-allergenic material in varying amounts, whereby the presence of biologically active compounds increases the risk of anaphylactic side effects. In addition, the lack or poor immunogenicity of clinically relevant allergens reduces the efficacy of extract-based vaccines (7). Substantial progress has been made in the field of allergen characterization during the last 20 years through the application of immunochemical and molecular biological techniques. Today, the most common and important allergens have been characterized regarding their structure and immunological properties. Recombinant allergens closely resembling the properties of the natural allergens have been produced and can now be used for the diagnosis and therapy of allergy (5). In addition it has been shown that allergen derivatives with beneficial immunological properties can be engineered (8). Modified variants of allergens with reduced allergenic activity have been generated, in order to avoid IgE-mediated side effects in the course of immunotherapy and recombinant Bet v 1-derived fragments with strongly reduced IgE-binding capacity have already been used in a clinical trial (9). Hybrid molecules consisting of combinations of different allergens have been shown to increase the immunogenicity of their single components (10-12). Linhart et al. (Ref. 21) prepared a hypoallergenic hybrid molecule with increased immunogenicity by combining hypoallergenic derivatives of the two major grass pollen allergens Phl p 2 and Phl p 6, namely a Phl p 2 mosaic molecule and a deletion mutant of Phl p 6, which was not surprising in light of previous data (Ref. 15, 17). The present inventors now have found that a combination of the hybrid technology and the mosaic technology does not in all cases lead to hypoallergenic molecules. Surprisingly, it has been observed that two fusion polypeptides which consisted of the same fragments but in a different order exhibited very different IgE reactivities. The present invention therefore provides a method for identifying polypeptides that have hypoallergenic properties and can serve as a potential vaccine. The present invention relates to a method for identifying hypoallergenic polypeptides, comprising the following steps:
In one embodiment at least two polypeptides within said group of polypeptides comprise the same fragments assembled in a different order. In another embodiment all fragments within said polypeptides have a length of from 20 to 100 amino acids. In another embodiment said polypeptides consist of 4 to 12 fragments derived from two different allergens. In another embodiment the method further comprises the step of evaluating the secondary structure of the polypeptides provided in step (a), and selecting the polypeptide(s) which exhibit(s) random coiled structure. In another embodiment said allergens are selected from the group consisting of the grass pollen allergens Phl p 1, Phl p 2, Phl p 3, Phl p 4, Phl p 5, Phl p 6, Phl p 7, Phl p 11, Phl p 12 and Phl p 13. In another embodiment each fragment consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 55 through 76. In another embodiment at least one polypeptide in said group comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 21 through 37. Another aspect of the present invention is a hypoallergenic polypeptide comprising at least four fragments derived from at least two different allergens, wherein the combined amino acid sequence of any pair of two adjacent fragments within the polypeptide is not present as a consecutive amino acid sequence in said allergens, characterized in that at least one fragment is derived from Phl p 1, Phl p 5, Phl p 2 or Phl p 6. Yet another aspect of the present invention is a hypoallergenic polypeptide comprising at least four fragments derived from at least two different allergens, wherein the combined amino acid sequence of any pair of two adjacent fragments within the polypeptide is not present as a consecutive amino acid sequence in said allergens, characterized in that each of said fragments consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 55 through 76. In one embodiment the hypoallergenic polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:22, 23, 24, 25, 36 and 37. In another embodiment the hypoallergenic polypeptide consists of an amino acid sequence selected from the group consisting of SEQ ID NOs:39, 40, 41, 42, 53 and 54. Another aspect of the invention is a pharmaceutical composition comprising the polypeptide of the invention and a pharmaceutically acceptable diluent or excipient. Another aspect of the invention is the use of the polypeptide of the invention for the manufacture of a medicament for the prevention and/or treatment of allergy, preferably of grass pollen allergy. Another aspect of the invention is a nucleic acid encoding the polypeptide of the present invention. Yet another aspect of the invention is a method of treating and/or preventing an allergic disorder, comprising administering to an individual in need thereof a therapeutically effective amount of the polypeptide or polynucleotide of this invention. The method of the invention is a method for identifying hypoallergenic polypeptides. Alternatively, the method of the invention is a screening method to identify hypoallergenic polypeptides. The term “hypoallergenic” as used herein, means the reduction of IgE reactivity and ability to induce IgE-mediated mast cell or basophil degranulation. In its first step, the method of the invention comprises providing a group of polypeptides, wherein each polypeptide within said group independently comprises N fragments derived from at least two different allergens. The group of polypeptides consists of at least two different polypeptides. Preferably, the group of polypeptides consists of 2 to 100, preferably of 3 to 75, more preferably of 4 to 50, most preferably of 5 to 30 different polypeptides. Each polypeptide independently comprises or consists of N fragments derived from at least two different allergens. N is an integer greater than 3, preferably N is 4 to 25, more preferably 4 to 20, still more preferably 4 to 15, most preferably 4 to 10 (e.g. 4, 5, 6, 7, 8, 9 or 10). The polypeptides within the group may comprise or consist of the same or a different number of fragments. That is, N may be the same or different for the respective polypeptides within the group. Preferably, all fragments within a given polypeptide are different from each other. Each fragment consists of at least 8, preferably of 8 to 100, more preferably of 10 to 90, still more preferably of 12 to 80, more preferably of 15 to 70, more preferably of 20 to 60 consecutive amino acids from an allergen amino acid sequence. The polypeptide prepared in accordance with this invention does not necessarily consist only of amino acid sequences derived from the allergens. It is possible that non-native sequences (e.g. spacer sequences) are inserted between the fragments (which fragments are consecutive amino acid sequences from different allergens). It is also possible that the polypeptides comprise a tag sequence which facilitates the purification of the polypeptide upon expression in a host cell. An example of such a tag sequence is a hexahistidine tag which allows purification by Ni2+ chelate chromatography. Other tags are known to those of skill in the art. Furthermore, the polypeptide may contain a foreign methionine residue at amino acid position 1 which results from expression in host cells. The methionine will often be present if the N-terminal portion of the polypeptide is an internal or C-terminal allergen fragment In one embodiment, the polypeptide may consist of any one of the following structures (I) to (VII):
The polypeptide in accordance with this invention may be prepared by various methods. In one embodiment the polypeptide is prepared by expressing a polynucleotide in a host cell. The host cell may be a prokaryotic or eukaryotic cell. If prokaryotic cells are used the host cell is preferably In another embodiment the polypeptide is prepared by chemical synthesis, e.g. by solid phase synthesis according to techniques that are known per se. The term “allergen” as used herein denotes a substance capable of eliciting a type I-hypersensitivity reaction in atopic individuals. Most humans mount significant Immunoglobulin E (IgE) responses only as a defense against parasitic infections. However; some individuals mount an IgE response against common environmental antigens. This hereditary predisposition is called atopy. In atopic individuals, non-parasitic antigens stimulate inappropriate IgE production, leading to type I hypersensitivity. Allergens in the sense of the present invention include allergens from plants and animals (Allergome database: www.allergome.org). The allergens are usually wildtype allergens. The allergens may be allergens from one or more of the following species: Preferably, one or more allergens are allergens from the species In a preferred embodiment of the method of the invention, all allergens from which the fragments are derived are from a single species from the list recited above. That is, the different ‘source allergens’ are all derived from the same species. A preferred group of allergens in accordance with this invention are grass pollen allergens, for example allergens from the species Other specific allergens from which the fragments can be derived include those disclosed in EP 1 817 330 B1, which are incorporated herein in their entirety by reference. The fragments are derived from at least two different allergens, preferably from 2 to 10 different allergens, more preferably from 2 to 5 different allergens, e.g. from 2, 3, 4 or 5 different allergens. In a special embodiment the group of polypeptides comprises at least 2 polypeptides which consist of the same fragments but wherein the fragments are assembled in a different order. In a further step the method of the invention comprises determining the IgE reactivity of the polypeptides. In a broad sense, the phrase “IgE reactivity” denotes the capability of a substance to bind to IgE antibodies. More specifically, as used herein, the phrase “IgE reactivity” refers to the capability of the polypeptide to bind to IgE antibodies from individuals that are allergic against one or more of the allergens from which the fragments within the polypeptide are derived. IgE reactivity may be measured by determining the degree of binding between (1) serum IgE from individuals that are allergic against one or more of the allergens from which the fragments are derived and (2) the polypeptide. This may be done by the method described in reference (18) or (19). Alternatively, IgE reactivity and allergenic activity may be determined by analysing the expression of CD203c on human basophils that were isolated from individuals allergic to one or more of said allergens. See example 4 and reference (20). In a further step the method of the invention comprises determining the T cell reactivity of the polypeptides. The phrase “T cell reactivity” as used herein refers to the capability of a substance to specifically bind to T cell receptors. More specifically, “T cell reactivity” means the capability of the polypeptide to induce proliferation of T cells. The T cell reactivity of the polypeptides can be measured by (1) providing peripheral blood mononuclear cells (PBMCs) isolated from individuals allergic against one or more of the allergens from which the fragments are derived, and (2) determining the degree of proliferation of T cells contained in said PBMCs. See example 5 and reference (16). In a further step the method of the invention comprises determining the capability of the polypeptides to induce an IgG response against one or more of the allergens from which the fragments are derived. This may be done by (1) immunizing a non-human mammal (e.g. a mouse, rat or rabbit) with the polypeptide, and (2) determining the amount of IgG antibodies raised in said non-human mammal, which are specific to said one or more allergen(s) from which the fragments are derived. The IgG antibodies measured are preferably IgG1 antibodies. Preferably, step (2) is performed using an ELISA assay. See example 6. The method further comprises determining to which extent the polypeptides are capable of inducing a protective IgG response. This may be done by (1) providing a composition containing IgG antibodies by immunizing a non-human mammal (e.g. a mouse, rat or rabbit) with the polypeptide; (2) providing a composition containing IgE antibodies from individuals that are allergic against one or more of said allergens from which the fragments of the polypeptide are derived, and (3) measuring whether and/or to which extent said composition containing IgG antibodies can block the binding of said IgE antibodies to one or more of said allergens. This test is preferably performed using an ELISA assay. For example, the wild type allergens from which the fragments are derived may be immobilized on an ELISA plate. The thus pre-treated ELISA plate may then be contacted with said composition containing the IgG antibodies to allow binding of IgG antibodies to said immobilized allergens. After washing the composition containing said IgE antibodies is contacted with the ELISA plate. After washing the amount of IgE antibodies are determined. See Example 7. The method of the invention comprises the final step of selecting those polypeptides which exhibit favourable properties and are thus useful for the potential use as a vaccine. To be selected a polypeptide must have the following properties:
Regarding item (i) above, the polypeptide is selected if its IgE reactivity is less than that of at least one allergen from which it is derived. Preferably, the polypeptide is selected only if its IgE reactivity is less than that of each allergen from which it is derived. For example, if the polypeptide consists of fragments derived from Phl p 2 and Phl p 5, the polypeptide must have a lower IgE reactivity than Phl p 2, and it must have a lower IgE reactivity than Phl p 5 to be selected. To be selected the IgE reactivity and allergenic activity are preferably reduced by at least 25%, more preferably by at least 50%, most preferably by at least 90%, determined by quantitative IgE measurements as described in Ref. 16, and as described in Example 4. Regarding requirement (ii), the polypeptide is selected only if it can elicit allergen-specific T cell activation (Example 5). Regarding condition (iii), the polypeptide is selected only if it can induce an allergen-specific IgG response upon immunization (see, e.g. Example 6). Regarding condition (iv), the polypeptide is selected only if the IgG antibodies induced by immunization can inhibit allergic patients' IgE binding to the wildtype allergen (see, e.g., Example 7). In a further aspect the invention relates to a hypoallergenic polypeptide identified and produced in accordance with this invention. The hypoallergenic polypeptide may comprise or consist of at least four fragments derived from at least two different allergens, wherein the amino acid sequence of any pair of two adjacent fragments within the polypeptide is not present as a consecutive amino acid sequence in said allergens, characterized in that at least one fragment is derived from Phl p 1 or Phl p 5. The number of fragments may be N, wherein N has the meaning as defined above. In another embodiment, the hypoallergenic polypeptide of the invention may comprise or consist of at least four fragments derived from at least two different allergens, wherein the amino acid sequence of any pair of two adjacent fragments within the fusion polypeptide is not present as a consecutive amino acid sequence in said allergens, characterized in that each of said fragments consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 55 through 76. These amino acid sequences are comprised in the fragments used in the examples of the present application. The number of fragments may be N, wherein N has the meaning as defined above. Preferably, The hypoallergenic polypeptide may consist of any one of the following structures (VIII) to (XIV):
More preferably, the hypoallergenic polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:22, 23, 24, 25, 36 and 37. These amino acid sequences are comprised in constructs B, C, D, E, P and Q, respectively (see Examples). The hypoallergenic polypeptide may consist of any one of the following structures (XV) to (XXI):
The polypeptide may consist of an amino acid sequence selected from the group consisting of SEQ ID NOs:39, 40, 41, 42, 53 and 54. The constructs B, C, D, E, P and Q consist of these amino acid sequences, respectively (see Examples). These embodiments correspond to structure (VIII) or (XV) above. All embodiments described above in connection with the method of the invention are applicable to the hypoallergenic polypeptide of the invention and vice versa. The invention further concerns a polynucleotide encoding the polypeptide of the present invention. Due to the degeneracy of the genetic code many different polynucleotide molecules may encode a single polypeptide. The polynucleotide of the invention preferably is an expression construct for obtaining the polypeptide after expression in host cells. The expression construct may further comprise components which are generally known in the art such as promoter sequences, genes encoding resistance factors against antibiotics, a replication origin and the like. The invention further concerns a cell transfected or transformed with a polynucleotide of the present invention. Suitable cells include eukaryotic cells and prokaryotic cells. Eukaryotic cells may be transfected by methods known in the art such as calcium phosphate mediated transfection, electroporation, lipofection etc. The invention further relates to a pharmaceutical composition containing the polypeptide, polynucleotide or cell according to this invention. The pharmaceutical composition may further contain one or more pharmaceutically acceptable carrier(s) or diluents(s) such as a buffer or salt solution. Preferably the pharmaceutical composition of the invention is a vaccine composition. In a particular embodiment the pharmaceutical composition further contains an adjuvant such as aluminium hydroxide. The invention also relates to a method for the preparation of the polypeptide of the invention. The method comprises providing a polynucleotide encoding the polypeptide, introducing said polynucleotide into a host cell, culturing the host cell thus obtained under conditions such that the hybrid polypeptide is expressed, in recovering the expression product from the cell. The polynucleotide may be prepared by methods known in the art. It may be preferred that PCR technology is used to prepare the polynucleotide encoding the polypeptide of the invention. The cDNA sequences of the grass pollen allergens Phl p 1, 2, 3, 4, 5, 6, 7, 11, 12, and 13 are shown in SEQ ID NO:11 to 20, respectively. Based on these sequences and on the disclosure in the present application, the skilled person can easily design suitable nucleic acids encoding polypeptides of the invention. The invention further relates to the use of the polypeptide, a polynucleotide or a cell described herein for the preparation of a medicament for the treatment and/or prevention of an allergic disorder. Such a medicament may be composed of the polynucleotide encoding a vaccine which can be used directly for the DNA-based vaccination against Type 1 allergy. The recombinant or synthetic polypeptide may be used to prepare formulations for the oral, sublingual or parenteral treatment of Type 1 allergic disorders as they are now routinely used for immunotherapy. Examples of formulations for sublingual immunotherapy or adjuvant bound hybrid polypeptide for injection immunotherapy. Possible applications include also cell-based forms of immunotherapy which may be based on e.g. dendritic cells or other antigen presenting cells. Those cells are transformed and expressed to antigen in vivo. Preferably orthologous cells transformed with suitable vectors are used. One mode of application may be the subcutaneous injection of adjuvant-bound polypeptide. Another possibility is oral or nasal administration of the polypeptide in order to induce immunological tolerance or anergy against the components of the polypeptide. All the possible formulations can be prepared according to measures which are known to those of skill in the art (dosage adjuvants scheme of administration). The invention further relates to the use of the polypeptide described herein or of a polypeptide or a cell described herein for the preparation of a medicament for prophylactic vaccination or tolerance induction. Prophylactic administration of hybrid polypeptides means the administration of the polypeptide to individuals, preferably children who do not yet suffer from Type 1 allergy in order to induce a state of immunological tolerance, anergy or non-responsiveness, or a protective immunity against the components of the hybrid vaccine. This may be achieved by the various protocols outlined for treatment of an established allergic disorder. The prophylactic treatment may be performed with the polypeptides or polynucleotides described herein above. In a further embodiment the invention relates to the use of a polypeptide described herein for the detection of antibodies against an allergenic protein in a sample. The antibody may be an IgM IgE, IgG or IgA antibody. The concentration of the antibody may be determined from a sample which has been obtained from a body fluid. The sample may be derived from animals or humans. Such tests may rely on a solid phase immobilized polypeptide or the polypeptide in the fluid phase. Examples for such tests include ELISA tests, Western blotting tests or any other tests where the polypeptide is immobilized to bind to specific antibodies out from the sample. Alternatively the polypeptide is added directly to the antibody containing fluid in order to adsorb specific antibodies as, e.g., in competitive immunological assays. The polypeptide of the invention may also be used for cellular tests such as a T cell proliferation test, etc. Summary of the amino acid and nucleotide sequences shown in the sequence listing: The amino acid sequences SEQ ID NO:1-10 show the mature peptides lacking the signal peptide, where applicable. The following examples further illustrate the invention. The scope of the invention, however, is not limited to the examples. In this study we demonstrate that these approaches can be combined and extended for a complex allergen source like grass pollen. We constructed a vaccine based on the four major allergens from timothy grass (Phl p 1, Phl p 2, Phl p 5, Phl p 6) for the treatment of grass pollen allergy (13, 14). Referring to structural data and epitope mapping studies the allergens were split into fragments with reduced allergenic activity. We describe the production of different combinations of these fragments as hybrid proteins, their biochemical and immunological properties and how four hybrid proteins were selected as candidate molecules for vaccination against grass pollen allergy. For construction of hypoallergenic hybrid molecules seventeen different hybrid molecules were designed by the assembly of allergen fragments derived from the major timothy grass pollen allergens Phl p 1, Phl p 2, Phl p 5, and Phl p 6 as shown in To evaluate the secondary structure of hybrid molecules far UV CD spectra of the proteins B, C, P, and Q dissolved in water were collected on a Jasco J-810 spectropolarimeter (Japan Spectroscopic Co., Tokyo, Japan) as described (16). All hybrid proteins, which were analyzed regarding their secondary structure, exhibited a random coiled structure, which has been observed previously for several other allergen derivatives (18, 19). To analyze the IgE reactivity of hybrid molecules the direct binding of serum IgE from grass pollen allergic patients to the Phl p 1, Phl p 2, Phl p 5-, and Phl p 6-derived hybrid molecules A-Q, or rPhl p 1, rPhl p 2, rPhl p 5, and rPhl p 6, or HSA as negative control, was investigated by non-denaturing dot blot experiments as described (18, 19). Patients' IgE antibodies bound to the recombinant ‘wildtype’ allergens Phl p 1, Phl p 2, Phl p 5, and Phl p 6, but not to the control protein HSA. Unexpectedly, we observed different IgE-reactivities of allergic patients' IgE to the hybrid molecules A-Q, which could not be explained by the primary structure (e.g. hybrids A and C, and hybrids E and F contain exactly the same allergen-derived fragments). Four hybrid molecules, B, C, P, and Q were selected for further analysis. To determine the IgE-reactivity of the hybrids B, C, P, and Q on IgE-dependent effector cell activation CD203c expression on human basophils isolated from grass pollen allergic patients was analyzed. CD203c has previously been described as an activation marker on human basophils, which is upregulated upon allergen-induced cross-linking of receptor-bound IgE (20). As shown in To evaluate the T cell reactivity of hybrid molecules in vitro proliferation experiments with PBMC isolated from four grass pollen allergic patients were performed as described (16). Although the allergenic activity of the hybrid molecules was reduced, most of the T cell epitopes of the wildtype Phl p 1, Phl p 2, Phl p 5, and Phl p 6 allergens were preserved. (Table II). To investigate whether IgG antibodies induced by immunization with B, C, P, or Q were able to recognize the rPhl p 1, rPhl p 2, rPhl p 5, and rPhl p 6 wildtype allergens two different animal models (BALB/c mice, rabbits) were used. We immunized BALB/c mice with a mixture of Phl p1 and Phl p 5, or a mixture of Phl p 2 and Phl p 6, or a mixture of B and C, or P, or Q, and compared the development of Phl p1-, Phl p 2-, Phl p 5-, and Phl p 6-specific IgG1antibody levels by ELISA measurements ( The development of allergen-specific IgG antibody responses was also investigated by immunization of rabbits with B, C, P, or Q. Serial dilutions of rabbit antisera were tested for Phl p 1-Phl p 2- Phl p 5- and Phl p 6-specific IgG antibodies by ELISA. The constructs B, C, P, and Q were able to induce an IgG antibody response to the wildtype allergens Phl p 1 ( To examine the ability of IgG antibodies induced with the hybrid molecules B, C, P, and Q to inhibit grass pollen allergic patients' IgE binding to rPhl p 1, Phl p 2, Phl p 5, and rPhl p 6, or to a natural grass pollen extract. In ELISA inhibition experiments we therefore preincubated an ELISA plate-bound natural grass pollen extract with a mixture of rabbit anti-P and Q antiserum, or a mixture of anti-B, C, and Q antiserum, or a rabbit antiserum obtained by immunization with a previously described grass pollen hybrid (GPH) (11) consisting of Phl p 1, Phl p 2, Phl p 5, and Phl p 6 or the corresponding preimmunesera. These rabbit IgG antibodies could inhibit IgE binding of 14 grass pollen allergic patients to the grass pollen extract as follows: P+Q: 73%; B+C+Q: 78%; GPH: 75% (Table III). Similar experiments were performed with ELISA plate-bound rPhl p 1, rPhl p 2, rPhl p 5, and Phl p 6, leading to an average inhibition of 81-94% for Phl p 1 (Table IV), 86-90% for Phl p 5 (Table V), 45% for Phl p 2 (Table VI), and 34% for Phl p 6 (Table VII). Serial dilutions of rabbit antisera were tested for Phl p 1-specific IgG antibodies by ELISA. The constructs B, C, and P, were able to induce an IgG antibody response to the wildtype allergen Phl p 1. The IgG response was compared to IgG antibody levels induced by immunization with a hybrid molecule consisting of the wildtype allergens Phl p 1, Phl p 2, Phl p 5, and Phl p 6 (grass pollen hybrid, GPH), which has previously been described as a highly immunogenic molecule (11). Unexpectedly, C and P induced even higher levels of Phl p 1-specific IgG antibodies in rabbits. The results are shown in The present invention relates to a method for identifying hypoallergenic polypeptides and to a corresponding screening method. The invention further relates to hypoallergenic polypeptides identified by the method of the invention and to the prophylactic and therapeutic use of these polypeptides. 1. A method for identifying hypoallergenic polypeptides, comprising the following steps:
a) providing a group of polypeptides, wherein each polypeptide in the group comprises N fragments derived from at least two different allergens, wherein N is an integer greater than 3, further wherein the amino acid sequence of any two adjacent fragments within any of said polypeptides is not present as a consecutive amino acid sequence in any one of said allergens; b) determining the IgE reactivity of the polypeptides; c) determining the T cell reactivity of the polypeptides; d) determining whether the polypeptides are capable of inducing an IgG response directed against said allergens; e) determining whether the polypeptides are capable of inducing a protective IgG response blocking allergic patients' IgE binding to said allergens; f) selecting those polypeptides that (i) have lower IgE reactivity than any one of said allergens, (ii) exhibit T cell reactivity, (iii) are capable of inducing an IgG response directed against one or more of said allergens, and (iv) are capable of inducing a protective IgG response blocking allergic patients' IgE binding to said allergens. 2. The method according to 3. The method according to 4. The method according to 5. The method according to 6. The method according to 7. The method according to 8. The method according to 9. A hypoallergenic polypeptide comprising at least four fragments derived from at least two different allergens, wherein the amino acid sequence of any two adjacent fragments within the polypeptide is not present as a consecutive amino acid sequence in said any of allergens, further wherein at least one fragment is derived from Phl p 1 or Phl p 5. 10. A hypoallergenic polypeptide comprising at least four fragments derived from at least two different allergens, wherein the amino acid sequence of any two adjacent fragments within the polypeptide is not present as a consecutive amino acid sequence in any of said allergens, further wherein each of said fragments consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 55 through 76. 11. The hypoallergenic polypeptide according to 12. The hypoallergenic polypeptide according to 13. A pharmaceutical composition comprising the hypoallergenic polypeptide according to 14. A method for the prevention and/or treatment of allergy comprising the step of administering an effective amount of the hypoallergenic polypeptide according to 15. A nucleic acid encoding the hypoallergenic polypeptide according to 16. The method according to BACKGROUND OF THE INVENTION
SUMMARY OF THE INVENTION
BRIEF DESCRIPTION OF THE DRAWINGS
DETAILED DESCRIPTION OF THE INVENTION
The Polypeptides
wherein Met is an N-terminal methionine residue, F1, F2 and FN are the first, second and Nth fragment, respectively, and tag is a tag sequence (e.g. a hexahistidine tag (His)6). In the above embodiments (I) through (VII), there are no foreign amino acids between the fragments. That is, F1-F2- . . . -FN is a consecutive sequence of allergen fragments. In other embodiments, there may be one or more (e.g. 1, 2 or 3) foreign amino acids between the fragments. This, however, is not preferred.
Allergens
Determination of IgE Reactivity
Determination of T Cell Reactivity
Induction of a Protective IgG Response
Selection of the Polypeptide
Hypoallergenic Polypeptides Identified by the Method of the Invention
wherein Met is an N-terminal methionine residue, F1, F2 and FN are the first, second and Nth fragment, respectively, and tag is a tag sequence (e.g. (His)6), each fragment consisting of an amino acid sequence selected from the group consisting of SEQ ID NOs: 55 through 76. The tag sequence usually is 5 to 10 amino acids in length.
wherein Met is an N-terminal methionine residue, SEQ is an amino acid sequence selected from the group consisting of SEQ ID NOs:22, 23, 24, 25, 36 and 37, and tag is a tag sequence (e.g. (His)6). The tag sequence usually is 5 to 10 amino acids in length.
Further Aspects of the Invention
1 Phl p 1 amino acid sequence 2 Phl p 2 amino acid sequence 3 Phl p 3 amino acid sequence 4 Phl p 4 amino acid sequence 5 Phl p 5 amino acid sequence 6 Phl p 6 amino acid sequence 7 Phl p 7 amino acid sequence 8 Phl p 11 amino acid sequence 9 Phl p 12 amino acid sequence 10 Phl p 13 amino acid sequence 11 Phl p 1 cDNA 12 Phl p 2 cDNA 13 Phl p 3 cDNA 14 Phl p 4 cDNA 15 Phl p 5 cDNA 16 Phl p 6 cDNA 17 Phl p 7 cDNA 18 Phl p 11 cDNA 19 Phl p 12 cDNA 20 Phl p 13 cDNA 21 construct A without N-terminal Met and C-terminal (His)6 22 construct B without N-terminal Met and C-terminal (His)6 23 construct C without N-terminal Met and C-terminal (His)6 24 construct D without N-terminal Met and C-terminal (His)6 25 construct E without N-terminal Met and C-terminal (His)6 26 construct F without N-terminal Met and C-terminal (His)6 27 construct G without N-terminal Met and C-terminal (His)6 28 construct H without N-terminal Met and C-terminal (His)6 29 construct I without N-terminal Met and C-terminal (His)6 30 construct J without N-terminal Met and C-terminal (His)6 31 construct K without N-terminal Met and C-terminal (His)6 32 construct L without N-terminal Met and C-terminal (His)6 33 construct M without N-terminal Met and C-terminal (His)6 34 construct N without N-terminal Met and C-terminal (His)6 35 construct O without N-terminal Met and C-terminal (His)6 36 construct P without N-terminal Met and C-terminal (His)6 37 construct Q without N-terminal Met and C-terminal (His)6 38 construct A with N-terminal Met and C-terminal (His)6 39 construct B with N-terminal Met and C-terminal (His)6 40 construct C with N-terminal Met and C-terminal (His)6 41 construct D with N-terminal Met and C-terminal (His)6 42 construct E with N-terminal Met and C-terminal (His)6 43 construct F with N-terminal Met and C-terminal (His)6 44 construct G with N-terminal Met and C-terminal (His)6 45 construct H with N-terminal Met and C-terminal (His)6 46 construct I with N-terminal Met and C-terminal (His)6 47 construct J with N-terminal Met and C-terminal (His)6 48 construct K with N-terminal Met and C-terminal (His)6 49 construct L with N-terminal Met and C-terminal (His)6 50 construct M with N-terminal Met and C-terminal (His)6 51 construct N with N-terminal Met and C-terminal (His)6 52 construct O with N-terminal Met and C-terminal (His)6 53 construct P with N-terminal Met and C-terminal (His)6 54 construct Q with N-terminal Met and C-terminal (His)6 55 P1a 56 P1b 57 P1c 58 P1d 59 P1a1 60 P1a2 61 P1c1 62 P1c2 63 P2A 64 P2B 65 P2a 66 P2b 67 P2c 68 P2a1 69 P2b2 70 P5a 71 P5b 72 P5c 73 P5d 74 P5c1 75 P5c2 76 P6b EXAMPLES
Example 1
Design, Expression, and Purification of the Hybrid Molecules
Phl p 1-derived fragments P1a IPKVPPGPNITATYGDKWLDAKSTWYGKPTGAGPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK P1b SGRGCGSCFFIKCTKPEACSGEPVVVHTTDDNEEPIAPYHFDLSGHAFGAMAKKGDEQKLR P1c SAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLVKYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKL P1d TGPFTVRYTTEGGTKTEAEDVIPEGWKADTSYESK P1a1 IPKVPPGPNTTATYGDKWLDAKSTWYGKPTGA P1a2 GPKDNGGACGYKDVDKPPFSGMTGCGNTPIFK P1c1 SAGELELQFRRVKCKYPEGTKVTFHVEKGSNPNYLALLV Plc2 KYVNGDGDVVAVDIKEKGKDKWIELKESWGAIWRIDTPDKL Phl p 5-derived fragments P5a ADLGYGPATPAAPAAGYTPATPAAPAEAAPAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATF P5b GAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPA P5c AEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFTPALEA P5d AVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV P5c1 AEEVKVIPAGELQVIEKVDAAFKVAATAANAAPA P5c2 NDKFTVFEAAFNDAIKASTGGAYESYKFIPALEA Phl p 2-derived fragments P2A VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEG P2B GVWTEDSEEPLQGPFNERFLTEKGMKNVFDDVVPEKYTIGATYAPEE P2a VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVEL P2b REHGSDEWVAMTKGEGGVWTFDSEEPLQGPFN P2c FRFLTEKGMKNVFDDVVPEKYTIGATYAPEE P2a1 VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGS P2b2 DEWVAMTKGEGGVWTFDSEEPLQGPFN Phl p 6-derived fragment P6b ADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA Example 2
Secondary Structure Estimation of the Hybrid Molecules
Example 3
IgE-Reactivity of the Hybrid Molecules
Example 4
Reduced Allergenic Activity of the Hybrid Molecules B, C, P, and Q
Example 5
T Cell Proliferations
PBMC from grass pollen allergic patients respond to the hybrid molecules 20 μg/ml 10 μg/ml 5 μg/ml 2.5 μg/ml 1.25 μg/ml rPhl p 1 + 2.5 2.6 2.0 1.3 1.6 rPhl p 5 (±1.5) (±1.8) (±1.1) (±0.1) (±0.7) B + C 1.7 2.1 2.2 2.0 1.4 (±1.1) (±1.5) (±1.4) (±0.9) (±0.5) P 2.0 2.2 2.0 2.7 2.5 (±1.5) (±1.4) (±0.6) (±1.2) (±1.2) rPhl p 2 + 1.6 1.3 1.5 1.3 1.5 rPhl p 6 (±0.9) (±0.69) (±0.6) (±0.7) (±0.4) Q 1.4 1.6 2.0 2.9 2.8 (±1.0) (±0.8) (±0.5) (±1.0) (±0.7) Example 6
Immunization with the Hybrid Molecules B, C, P, and Q Induced an IgG Response Directed Against the Wildtype Allergens
Example 7
Immunization with the Hybrid Allergens B, C, P, and Q Induced a Protective IgG Response Blocking Allergic Patients' IgE Binding to the Wild-Type Allergens and Grass Pollen Extract
% Inhibition of patients' IgE binding to GPE after preincubation with rabbit antisera patient P + Q B + C+ Q GPH 1 90 93 92 2 28 23 14 3 84 89 87 4 75 81 78 5 61 71 70 6 78 84 86 7 81 86 86 8 80 80 80 9 76 83 73 10 66 71 75 11 76 87 86 12 70 80 72 13 72 81 75 14 84 89 82 mean 73 78 75 SD 15.0 17.1 18.9 % inhibition of patients' IgE binding to rPhl p 1 after preincubation with rabbit antisera patient B + C B C P GPH 1 84 86 91 90 66 2 97 82 97 94 46 3 92 77 93 90 44 4 73 69 79 76 47 5 90 86 91 89 57 6 94 80 96 92 43 7 93 81 98 96 44 8 98 93 100 99 67 9 96 82 98 92 44 10 98 78 99 94 44 mean 92 81 94 91 50 SD 7.8 6.4 6.2 6.1 9.5 % Inhibition of patients' IgE binding to rPhl p 5 after preincubation with rabbit antisera patient B + C B C P GPH 1 92 93 94 94 94 2 93 91 90 95 97 3 92 86 90 92 93 4 86 82 86 89 89 5 87 83 90 91 92 6 93 88 91 94 96 7 95 91 95 96 98 8 95 92 94 97 98 9 68 63 66 52 52 10 95 90 92 97 99 mean 90 86 89 90 91 SD 8.2 8.9 8.4 13.5 14.0 % Inhibition of patients' IgE binding to rPhl p 2 after preincubation with rabbit antisera patient Q GPH 1 52 86 2 50 87 3 41 71 4 60 76 5 46 83 6 43 74 7 47 60 8 31 45 9 36 54 mean 45 71 SD 8.7 14.8 % Inhibition of patients' IgE binding to rPhl p 6 after preincubation with rabbit antisera patient Q GPH 1 38 55 2 38 53 3 36 52 4 29 47 5 32 46 6 40 51 7 32 38 8 41 59 9 23 32 mean 34 48 SD 5.9 8.5 Example 8
Immunization with the Hybrid Molecules B, C, and P Induced an IgG Response Directed Against the Wildtyp Allergen Phl p 1
REFERENCES










