Immunogenic Compositions of Staphylococcus Epidermidis Polypeptide Antigens

The present invention relates to immunogenic compositions, comprising polypeptides isolated from . The invention also relates to polynucleotides encoding polypeptides and their use in immunogenic compositions. In addition, the invention relates to methods of inducing an immune response in mammals against and using immunogenic compositions of the polypeptides and polynucleotides. The invention also relates to methods for detecting in a biological sample. 1Staphylococcus epidermidis.. An immunogenic composition comprising one or more isolated polypeptides comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1 through SEQ ID NO: 32 , a biological equivalent thereof , or a fragment thereof , wherein at least one of the one or more isolated polypeptides is derived from2Staphylococcus epidermidis.. The immunogenic composition of claim 1 , wherein the one or more isolated polypeptides are immunoreactive with antibodies in the serum of rabbits infected with3. The immunogenic composition of claim 1 , wherein the one or more isolated polypeptides binds to one or more rabbit serum proteins.4. The immunogenic composition of claim 1 , further comprising a pharmaceutically acceptable carrier.5. The immunogenic composition of claim 1 , further comprising one or more adjuvants.6. (canceled)7. The immunogenic composition of claim 1 , wherein the one or more isolated polypeptides further comprises heterologous amino acids.8. The immunogenic composition of claim 1 , wherein at least one of the one or more isolated polypeptides is a fusion polypeptide.9. The immunogenic composition of claim 1 , wherein at least one of the one or more isolated polypeptides is a recombinant polypeptide.10. (canceled)11Staphylococcus epidermidis.. The immunogenic composition of claim 1 , wherein the one or more isolated polypeptides comprise a neutralizing epitope of12. The immunogenic composition of claim 1 , wherein at least one of the one or more isolated polypeptides is a ...

ANTIBODIES THAT SPECIFICALLY BIND STAPHYLOCOCCUS AUREUS ALPHA TOXIN AND METHODS OF USE

Herein provided are compositions, methods of manufacture and methods of use pertaining to anti-alpha toxin antibodies and fragments. 184-. (canceled)85Staphylococcus aureus. An isolated antibody or antigen-binding fragment thereof , wherein the isolated antibody or antigen-binding fragment thereof immunospecifically binds to a alpha toxin polypeptide and comprises:(a) a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 7, 10, 13 or 69;(b) a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 8, 11, 14, 17, 70 or 75;(c) a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 9, 12, 15, 18, 16, 65, 66, 67, 71, 72, 76 or 78;(d) a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 1 or 4;(e) a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 2, 5, 73 or 77; and(f) a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 6, 64, 68 or 74.86. The antibody or antigen binding fragment of claim 85 , wherein the VH CDR1 claim 85 , VH CDR2 claim 85 , VH CDR3 claim 85 , VL CDR1 claim 85 , VL CDR2 and VL CDR3 correspond to the amino acid sequences of SEQ ID NOs: 7 claim 85 , 8 claim 85 , 9 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 10 claim 85 , 11 claim 85 , 12 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 13 claim 85 , 14 claim 85 , 15 claim 85 , 4 claim 85 , 5 and 6; SEQ ID NOs: 7 claim 85 , 17 claim 85 , 18 claim 85 , 1 claim 85 , 2 and 3; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 16 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 65 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs; 7 claim 85 , 8 claim 85 , 66 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 67 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 67 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 78 claim 85 , 1 claim 85 , 2 and 64; SEQ ID NOs: 7 claim 85 , 8 claim 85 , 65 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: 69 claim 85 , 70 claim 85 , 71 claim 85 , 1 claim 85 , 2 and 68; SEQ ID NOs: ...

ANTIBODIES TO S. AUREUS SURFACE DETERMINANTS

Antibodies and antigen binding fragments thereof directed against () surface determinant antigens and secreted toxins are disclosed. Methods of detecting, diagnosing and treating using the antibodies and antigen binding fragments thereof are also provided. 1Staphylococcus aureusS. aureus. An isolated antibody or antigen binding fragment thereof that specifically binds to the () IsdH surface determinant antigen ,wherein the isolated antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) and a light chain variable region (VH), each of which comprises three complementarity determining regions (CDR1, CDR2, and CDR3)and wherein:a. a VH CDR1 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 90, 96, 102, 108, or 114;b. a VH CDR2 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 91, 97, 103, 109, or 115; andc. a VH CDR3 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 92, 98, 104, 110, or 116;and/ord. a VL CDR1 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 93, 99, 105, 111, or 117:e. a VL CDR2 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 94, 100, 106, 112, or 118; andf. a VL CDR3 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 95, 101, 107, 113, or 119.27.-. (canceled)8. An isolated antibody or antigen binding fragment thereof of claim 1 , wherein the VH amino acid sequence is at least 80% claim 1 , 85% claim 1 , 90% claim 1 , 95% or 100% identical to the amino acid sequence of SEQ ID NO: 80 claim 1 , 82 claim 1 , 84 claim 1 , 86 claim 1 , or 88 and/or the VL amino acid sequence is at least 80% claim 1 , 85% ...

COMBINATION THERAPIES USING ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES

This disclosure relates to combination therapies comprising anti-Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of infection. 173-. (canceled)74Pseudomonas. An isolated binding molecule or antigen binding fragment thereof that specifically binds to PcrV , wherein the binding molecule:{'i': 'Pseudomonas', '(a) binds to the same PcrV epitope as an antibody or antigen-binding fragment thereof comprising a heavy chain variable region (VH) comprising the amino acid sequence SEQ ID NO: 216 and a light chain variable region (VL) comprising the amino acid sequence SEQ ID NO: 217;'}{'i': 'Pseudomonas', '(b) competitively inhibits PcrV binding by an antibody or antigen-binding fragment thereof comprising a VH comprising the amino acid sequence SEQ ID NO: 216 and a VL comprising the amino acid sequence SEQ ID NO: 217; or'}(c) a combination of (a) and (b).75. The binding molecule of claim 74 , comprising:(a) a heavy chain CDR1 comprising SYAMN (SEQ ID NO:218), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; a heavy chain CDR2 comprising AITISGITAYYTDSVKG (SEQ ID NO: 219), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; and a heavy chain CDR3 comprising EEFLPGTHYYYGMDV (SEQ ID NO: 220), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions;(b) a light chain CDR1 comprising RASQGIRNDLG (SEQ ID NO: 221), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; a light chain CDR2 comprising SASTLQS (SEQ ID NO: 222), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; and a light chain CDR3 comprising LQDYNYPWT (SEQ ID NO: 223), or a variant thereof comprising 1, 2, 3, or 4 conservative amino acid substitutions; or(c) a combination of (a) and (b).76. The binding molecule of claim 74 , comprising:(a) a heavy chain variable region having at least 90% sequence identity to SEQ ID ...

ANTIBODY DIRECTED AGAINST S. AUREUS CLUMPING FACTOR A (ClfA)

The present disclosure is directed to a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to a Staphylococcus aureus clumping factor A protein (ClfA), as well as compositions comprising the monoclonal antibody. The disclosure also is directed to methods of treating a Staphylococcus aureus infection by administering the anti-ClfA monoclonal antibody alone, or in combination with a monoclonal antibody that specifically binds to S. aureus alpha toxin (AT) protein to a subject. Bispecific monoclonal antibodies that specifically bind to both ClfA and AT and methods of using the same also are provided.

ANTIBODY DIRECTED AGAINST S. AUREUS CLUMPING FACTOR A (ClfA)

The present disclosure is directed to a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to a clumping factor A protein (ClfA), as well as compositions comprising the monoclonal antibody. The disclosure also is directed to methods of treating a infection by administering the anti-ClfA monoclonal antibody alone, or in combination with a monoclonal antibody that specifically binds to alpha toxin (AT) protein to a subject. Bispecific monoclonal antibodies that specifically bind to both ClfA and AT and methods of using the same also are provided. 13-. (canceled)4S. aureus. An antibody or antigen-binding fragment thereof that specifically binds to a ClfA protein , wherein said antibody or antigen-binding fragment comprises (1) a VH , (2) a VL , and (3) a heavy chain constant domain comprising the amino acid sequence of CSYHLC (SEQ ID NO: 21); wherein the VH comprises the amino acid sequence of SEQ ID NO: 13 , or wherein the VL comprises the amino acid sequence of SEQ ID NO: 14.518-. (canceled)19S. aureusS. aureus. A bispecific antibody or antigen-binding fragment thereof that specifically binds to a ClfA protein and specifically binds to a alpha toxin (AT) protein , wherein the antibody or antigen-binding fragment comprises a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 1 , a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 2 , a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 3 , a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 4 , a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 5 , and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 6.2024-. (canceled)25S. aureus. An antibody or antigen-binding fragment thereof that specifically binds to a ClfA protein , wherein said antibody or antigen-binding fragment comprises the VH CDR1 , VH CDR2 , VH CDR3 , VL CDR1 , VL CDR2 , and VL CDR3 of SAR72 , SAR80 , SAR113 , SAR132 , SAR352 , SAR372 , SAR510 , SAR547 , SAS1 , SAS19 , or SAS203.26 ...

COMBINATIONS OF ANTI-STAPHYLOCOCCUS AUREUS ANTIBODIES

The present disclosure is directed to anti-antibody combinations including combinations of antibodies that bind to alpha toxin (AT) protein, clumping factor A protein (ClfA), and/or at least one leukotoxin protein. Methods of treating and preventing infections comprising administering the antibody combinations are also provided herein. 1Staphylococcus aureusS. aureusS. aureusS. aureusS. aureus. A method of preventing a () infection in a subject comprising administering to the subject (a) an antibody or antigen-binding fragment thereof that binds to alpha toxin (AT) , (b) an antibody or antigen-binding fragment thereof that binds to clumping factor A (ClfA) , and (c) an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin.2Staphylococcus aureusS. aureusS. aureusS. aureusS. aureus. A method of treating or preventing a () infection in a subject comprising administering to the subject an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin and (a) an antibody or antigen-binding fragment thereof that binds to alpha toxin (AT) or (b) an antibody or antigen-binding fragment thereof that binds to clumping factor A (ClfA).3S. aureusS. aureusS. aureus. A composition comprising (a) an antibody or antigen-binding fragment thereof that binds to AT , (b) an antibody or antigen-binding fragment thereof that binds to ClfA , and (c) an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin.4S. aureusS. aureusS. aureus. A composition comprising an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin and (a) an antibody or antigen-binding fragment thereof that binds to AT or (b) an antibody or antigen-binding fragment thereof that binds to ClfA.512-. (canceled)13S. aureusS. aureus. The method of claim 1 , wherein the antibody or antigen-binding fragment thereof that binds to AT binds to the same AT epitope as an antibody comprising a VH comprising the amino acid ...

METHODS OF USING ANTI-ALPHA TOXIN ANTIBODY

Provided herein are methods of preventing and treating a bacterial infection, e.g., a infection, in a patient, comprising administering to the patient an effective amount of an anti-alpha toxin antibody or an antigen-binding fragment thereof, such as MEDI4893. 1. A method of treating or preventing a nosocomial infection in a subject , or decreasing the severity of a nosocomial infection in a subject , comprising administering 2000 to 5000 milligrams of an anti-alpha toxin antibody or antigen-binding fragment thereof to the subject , wherein the antibody or antigen-binding fragment thereof comprises a set of Complementarity-Determining Regions (CDRs): HCDR1 , HCDR2 , HCDR3 , LCDR1 , LCDR2 , and LCDR3 wherein ,HCDR1 has the amino acid sequence of SEQ. ID. NO: 1;HCDR2 has the amino acid sequence of SEQ. ID. NO: 2;HCDR3 has the amino acid sequence of SEQ. ID. NO: 3;LCDR1 has the amino acid sequence of SEQ. ID. NO: 4;LCDR2 has the amino acid sequence of SEQ. ID. NO: 5; andLCDR3 has the amino acid sequence of SEQ. ID. NO: 6.2. A method according to claim 1 ,wherein the serum target level of said antibody or antigen-binding fragment thereof is in a range of about 100 μg/ml to about 1000 μg/ml.39-. (canceled)10. A method of treating or preventing pneumonia in a subject comprising administering 2000 to 5000 milligrams of an anti-alpha toxin antibody or antigen-binding fragment thereof to the subject claim 1 , wherein the antibody or antigen-binding fragment thereof comprises a set of CDRs: HCDR1 claim 1 , HCDR2 claim 1 , HCDR3 claim 1 , LCDR1 claim 1 , LCDR2 claim 1 , and LCDR3 wherein claim 1 ,HCDR1 has the amino acid sequence of SEQ. ID. NO: 1;HCDR2 has the amino acid sequence of SEQ. ID. NO: 2;HCDR3 has the amino acid sequence of SEQ. ID. NO: 3;LCDR1 has the amino acid sequence of SEQ. ID. NO: 4;LCDR2 has the amino acid sequence of SEQ. ID. NO: 5; andLCDR3 has the amino acid sequence of SEQ. ID. NO: 6.11. A method of treating or preventing pneumonia in a human subject ...

COMBINATION THERAPIES USING ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES

This disclosure relates to combination therapies comprising anti-Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of infection. 173-. (canceled)74PseudomonasPseudomonas. An isolated antibody or antigen-binding fragment thereof that specifically binds to PcrV , wherein the antibody or antigen-binding fragment thereof binds to the same PcrV epitope as a reference antibody comprising a heavy chain variable region (VH) comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a light chain variable region (VL) comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF SGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPWTFGQGTKVEIK (amino acids 1-107 of SEQ ID NO:263).75. The isolated antibody or antigen-binding fragment thereof of claim 74 , wherein the antibody or antigen-binding fragment thereof comprises:(a) a heavy chain complementarity-determining region (CDR)1 comprising SYAMN (SEQ ID NO:218); a heavy chain CDR2 comprising AITMSGITAYYTDDVKG (amino acids 50-66 of SEQ ID NO:264); and a heavy chain CDR3 comprising EEFLPGTHYYYGMDV (SEQ ID NO: 220); and(b) a light chain CDR1 comprising RASQGIRNDLG (SEQ ID NO: 221); a light chain CDR2 comprising SASTLQS (SEQ ID NO: 222); and a light chain CDR3 comprising LQDYNYPWT (SEQ ID NO: 223).76PseudomonasPseudomonas. An isolated antibody or antigen-binding fragment thereof that specifically binds to PcrV claim 74 , wherein the antibody or antigen-binding fragment thereof competitively inhibits PcrV binding by a reference antibody comprising a VH comprising amino acids EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMNWVRQAPGKGLEWVSAITMSGITAYY TDDVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEEFLPGTHYYYGMDVWGQGTT VTVSS (amino acids 1-124 of SEQ ID NO:264) and a VL comprising amino acids AIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYSASTLQSGVPSRF ...

MULTISPECIFIC AND MULTIVALENT BINDING PROTEINS AND USES THEREOF

The disclosure generally provides proteins that bind two epitopes (e.g., a first and a second epitope) and that are bivalent for binding to each of the first and second epitopes. The disclosure also provides compositions comprising such proteins, nucleic acid molecules encoding such proteins and methods of making and using such proteins. 1. A protein , comprising:a Fab arm that binds to a first epitope,a binding domain (BD) that binds to a second epitope, and{'sub': H', 'H, 'an Fc region comprising C2 and C3 domains;'}wherein the BD is interconnected to the Fab arm via a first polypeptide linker (L1) and to the Fc region via a second polypeptide linker (L2); and wherein the protein is bivalent for binding to each of the first and second epitopes.2. The protein of claim 1 , wherein the L1 comprises 1-50 amino acid residues.3. The protein of claim 1 , wherein the L2 comprises 1-50 amino acid residues.4. The protein of claim 1 , wherein each of the L1 and the L2 comprises 1-50 amino acid residues.5. The protein of claim 1 , wherein each of the L1 and the L2 comprises 15-30 amino acid residues.6. The protein of claim 1 , wherein the L1 comprises a hinge portion and a linker portion.7. The protein of claim 1 , wherein the L2 comprises a hinge portion and a linker portion.8. The protein of claim 1 , wherein each of the L1 and the L2 comprises a hinge portion and a linker portion.9. The protein of claim 1 , wherein the L1 comprises at least 5 amino acid residues of an antibody hinge region.10. The protein of claim 1 , wherein the L2 comprises at least 5 amino acid residues of an antibody hinge region.11. The protein of claim 1 , wherein the L1 comprises at least 7 amino acid residues of an antibody hinge region.12. The protein of claim 1 , wherein the L2 comprises at least 7 amino acid residues of an antibody hinge region.13. The protein of claim 1 , wherein the L2 comprises at least 12 amino acid residues of an antibody hinge region.14. The protein of claim 1 , wherein ...

COMBINATIONS OF ANTI-STAPHYLOCOCCUS AUREUS ANTIBODIES

The present disclosure is directed to anti-antibody combinations including combinations of antibodies that bind to alpha toxin (AT) protein, clumping factor A protein (C1fA), and/or at least one leukotoxin protein. Methods of treating and preventing infections comprising administering the antibody combinations are also provided herein. 1Staphylococcus aureusS. aureusS. aureusS. aureusS. aureus. A method of treating or preventing a () infection in a subject comprising administering to the subject (a) an antibody or antigen-binding fragment thereof that binds to alpha toxin (AT) , (b) an antibody or antigen-binding fragment thereof that binds to clumping factor A (C1fA) , and (c) an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin.2Staphylococcus aureusS. aureusS. aureusS. aureusS. aureus. A method of treating or preventing a () infection in a subject comprising administering to the subject an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin and (a) an antibody or antigen-binding fragment thereof that binds to alpha toxin (AT) or (b) an antibody or antigen-binding fragment thereof that binds to clumping factor A (C1fA).3S. aureusS. aureusS. aureus. A composition comprising (a) an antibody or antigen-binding fragment thereof that binds to AT , (b) an antibody or antigen-binding fragment thereof that binds to C1fA , and (c) an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin.4S. aureusS. aureusS. aureus. A composition comprising an antibody or antigen-binding fragment thereof that binds to at least one leukotoxin and (a) an antibody or antigen-binding fragment thereof that binds to AT or (b) an antibody or antigen-binding fragment thereof that binds to C1fA.512-. (canceled)13S. aureusS. aureus. The method of claim 1 , wherein the antibody or antigen-binding fragment thereof that binds to AT binds to the same AT epitope as an antibody comprising a VH comprising the amino ...

ANTIBODIES DIRECTED AGAINST STAPHYLOCOCCUS AUREUS LEUKOTOXINS

The present disclosure is directed to leukotoxin-binding antibodies and antigen-binding fragments thereof. The antibodies and fragments can be used, for example, to detect leukotoxin and/or in methods of treating and preventing infections. 1S. aureus. An antibody or antigen-binding fragment thereof that specifically binds to at least one leukotoxin wherein the antibody or antigen-binding fragment comprises a variable heavy chain (VH) complementarity determining region (CDR) 1 , a VH CDR2 , a VH CDR3 , a variable light chain (VL) CDR1 , a VL CDR2 , and a VL CDR3 , wherein the VH CDR1 , VH CDR2 , VH CDR3 , VL CDR1 , VL CDR2 , and VL CDR3 comprise sequences selected from the group consisting of: (a) SEQ ID NOs:1 , 2 , 3 , 12 , 5 , and 6 , respectively; (b) SEQ ID NOs:1-6 , respectively; (c) SEQ ID NOs:1 , 2 , 17 , 4 , 5 , and 6 , respectively; (d) SEQ ID NOs: 1 , 2 , 17 , 12 , 5 , and 6 , respectively; and (e) SEQ ID NOs: 1 , 20 , 3 , 4 , 5 , and 6 , respectively.2S. aureus. An antibody or antigen-binding fragment thereof that specifically binds to at least one leukotoxin wherein the antibody or antigen-binding fragment comprises the VH CDR1 , VH CDR2 , VH CDR3 , VL CDR1 , VL CDR2 , and VL CDR3 of SAN481-SYT-YTE.3. (canceled)4. The antibody or antigen-binding fragment thereof of claim 1 , wherein the antibody or antigen-binding fragment thereof comprises a VH and a VL claim 1 , wherein the VH comprises the amino acid sequence of SEQ ID NO:7 claim 1 , 15 claim 1 , 18 claim 1 , 21 claim 1 , or 23 and/or the VL comprises the amino acid sequence of SEQ ID NO:8 or 13.5. (canceled)6. The antibody or antigen-binding fragment thereof of claim 4 , wherein the antibody or antigen-binding fragment thereof comprises a VH and a VL claim 4 , wherein the VH and VL comprise sequences selected from the group consisting of: (a) SEQ ID NOs:15 and 13 claim 4 , respectively; (b) SEQ ID NOs:7 and 8 claim 4 , respectively; (c) SEQ ID NOs:7 and 13 claim 4 , respectively; (d) SEQ ID NOs:15 and ...

TREATMENT OF POLYBACTERIAL INFECTIONS

Provided herein are methods of preventing and treating polybacterial infections comprising administering an effective amount of an antibody or antigen-binding fragment thereof that specifically binds to an epitope produced by at least one of the bacterium in the polybacterial infection. For example, an antibody that specifically binds to alpha toxin can be administered to a patient with a polybacterial infection comprising and to inhibit the growth of 1Staphylococcus aureusS. aureusS. aureus. A method of treating or preventing a polybacterial infection in a patient comprising administering an antibody or antigen-binding fragment thereof that specifically binds to a () antigen , wherein the polybacterial infection comprises and at least one other bacterium.2S. aureus. The method of claim 1 , wherein the potentiates the growth of the at least one other bacterium in the patient.3. The method of claim 1 , wherein the administration inhibits the growth of the at least one other bacterium.4Pseudomonas, KlebsiellaAcinetobacter.. The method of claim 1 , wherein the at least one other bacterium is or5PseudomonasPseudomonas aeruginosaP. aeruginosaKlebsiellaKlebsiella pneumoniaeK. pneumoniaeAcinetobacterAcinetobacter baumanniiA. baumannii. The method of claim 4 , wherein the is () claim 4 , the is () or the is ().6P. aeruginosaP. aeruginosa. A method of treating or preventing a polybacterial infection in a patient comprising administering an antibody or antigen-binding fragment thereof that specifically binds to a antigen claim 4 , wherein the polybacterial infections comprises and at least one other bacterium.7P. aeruginosa. The method of claim 6 , wherein the potentiates the growth of the at least one other bacterium in the patient.8. The method of claim 6 , wherein the administration inhibits the growth of the at least one other bacterium.9Staphylococcus, KlebsiellaAcinetobacter.. The method of claim 6 , wherein the at least one other bacterium is or10S. aureus, K. ...

MULTI-SPECIFIC ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES AND USES THEREOF

This disclosure relates to combination therapies comprising anti-Psl and PcrV bispecific binding molecules and related compositions, for use in prevention and treatment of infection. 1PseudomonasPseudomonas. A bispecific antibody comprising a binding domain that binds to Psl and a binding domain that binds to PcrV.2. The bispecific antibody of claim 1 , wherein the Psl binding domain comprises a scFv fragment and the PcrV binding domain comprises an intact immunoglobulin.3. The bispecific antibody of claim 1 , wherein the Psl binding domain comprises an intact immunoglobulin and the PcrV binding domain comprises a scFv fragment.4. The bispecific antibody of comprising a Bs-2 molecule claim 2 , wherein the scFv is fused to the amino-terminus of the VH region of the intact immunoglobulin.5. The bispecific antibody of comprising a Bs-3 molecule claim 2 , wherein the scFv is fused to the carboxy-terminus of the CH3 region of the intact immunoglobulin.6. (canceled)7. (canceled)8. The bispecific antibody of claim 1 , wherein the anti-Psl binding domain comprises a VH and VL region at least 90% identical to the corresponding region of WapR-004-RAD.9. The bispecific antibody of claim 8 , wherein the WapR-004-RAD VH and VL are arranged as a ScFv.10. (canceled)11. (canceled)12. The bispecific antibody of claim 1 , wherein the anti-PcrV binding domain comprises VH and VL regions at least 90% identical to the corresponding regions of V2L2.13. The bispecific antibody of claim 8 , comprising Bs-2-GLO claim 8 , Bs-3-GLO claim 8 , or Bs-4-GLO.14. A cell comprising or producing the bispecific antibody of .15. An isolated polynucleotide molecule comprising a polynucleotide that encodes the bispecific antibody of .16. A vector comprising the polynucleotide of .17. A cell comprising the vector of .18. A composition comprising the bispecific antibody of and a pharmaceutically acceptable carrier.19. The bispecific antibody of claim 1 , which is conjugated to an agent selected from the ...

Immunogenic Compositions Of Staphylococcus Epidermidis Polypeptide Antigens

The present invention relates to immunogenic compositions, comprising polypeptides isolated from . The invention also relates to polynucleotides encoding polypeptides and their use in immunogenic compositions. In addition, the invention relates to methods of inducing an immune response in mammals against and using immunogenic compositions of the polypeptides and polynucleotides. The invention also relates to methods for detecting in a biological sample. 129-. (canceled)30Staphylococcus epidermidisStaphylococcus aureus. A method of inducing an immune response against or comprising administering to a mammal an immunogenic amount of a composition comprising an isolated polypeptide having at least about 95% identity to an amino acid sequence chosen from one or more of SEQ ID NO: 1 through SEQ ID NO: 32 or a biological equivalent thereof , or a fragment thereof , and a pharmaceutically acceptable carrier.31. The method of claim 30 , wherein the polypeptide further comprises heterologous amino acids.32. The method of claim 31 , wherein the polypeptide is a fusion polypeptide.33. The method of claim 30 , wherein the composition further comprises an adjuvant.34. The method of claim 30 , wherein the polypeptide is a recombinant polypeptide.35Staphylococcus epidermidisStaphylococcus aureus. A method of inducing an immune response against or comprising administering to a mammal an immunogenic amount of a composition comprising an isolated polypeptide encoded by a polynucleotide having at least about 95% identity to a nucleotide sequence chosen from one or more of SEQ ID NO: 33 through SEQ ID NO: 64 claim 30 , a degenerate variant thereof claim 30 , or a fragment thereof and a pharmaceutically acceptable carrier.3637-. (canceled)38. The method of claim 35 , wherein the polynucleotide is a recombinant polynucleotide.39. The method of claim 35 , wherein the polynucleotide further comprises heterologous nucleotides.40. (canceled)41. The method of claim 35 , wherein the composition ...

Combination therapies using anti-pseudomonas psl and pcrv binding molecules

The disclosure relates to combination therapies comprising anti- Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.

ANTIBODIES TO S. AUREUS SURFACE DETERMINANTS

Antibodies and antigen binding fragments thereof directed against () surface determinant antigens and secreted toxins are disclosed. Methods of detecting, diagnosing and treating using the antibodies and antigen binding fragments thereof are also provided. 1Staphylococcus aureusS. aureus. An isolated antibody or antigen binding fragment thereof that specifically binds to the () IsdH surface determinant antigen ,wherein the isolated antibody or antigen binding fragment thereof comprises a heavy chain variable region (VH) and a light chain variable region (VH), each of which comprises three complementarity determining regions (CDR1, CDR2, and CDR3)and wherein:a. a VH CDR1 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 90, 96, 102, 108, or 114;b. a VH CDR2 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 91, 97, 103, 109, or 115; andc. a VH CDR3 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 92, 98, 104, 110, or 116;and/ord. a VL CDR1 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 93, 99, 105, 111, or 117;e. a VL CDR2 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 94, 100, 106, 112, or 118; andf. a VL CDR3 is identical to, or comprises 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 95, 101, 107, 113, or 119.2. The isolated antibody or antigen binding fragment thereof of claim 1 , wherein the isolated antibody or antigen binding fragment thereof comprises:a. a VH CDR1 identical to, or comprising 1, 2, or 3 amino acid residue mutations relative to, the amino acid sequence of SEQ ID NO: 90, 96, 102, 108, or 114;b. a VH CDR2 identical to, or comprising 1, 2, or 3 amino ...

COMBINATION THERAPIES USING ANTI-PSEUDOMONAS PSL AND PCRV BINDING MOLECULES

This disclosure relates to combination therapies comprising anti-Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of infection. 1Pseudomonas. An isolated antibody or antigen binding fragment thereof that specifically binds PcrV , which comprises:(a) a heavy chain CDR1 comprising SYAMN (SEQ ID NO:218); a heavy chain CDR2 comprising AITMSGITAYYTDDVKG (amino acids 50-66 of SEQ ID NO:264); and a heavy chain CDR3 comprising EEFLPGTHYYYGMDV (SEQ ID NO: 220); and(b) a light chain CDR1 comprising RASQGIRNDLG (SEQ ID NO: 221); a light chain CDR2 comprising SASTLQS (SEQ ID NO: 222); and a light chain CDR3 comprising LQDYNYPWT (SEQ ID NO: 223).24.-. (canceled)6PseudomonasPseudomonas. An isolated antibody or antigen binding fragment thereof that (i) specifically binds to the same PcrV epitope as a reference antibody comprising the amino acid sequences of SEQ ID NO:264 and 263 or (ii) competitively inhibits PcrV binding by a reference antibody comprising the amino acid sequences of SEQ ID NO:264 and 263.7. (canceled)8. The antibody or fragment thereof of claim 1 , which is recombinant.9. The antibody or fragment thereof of claim 1 , which is monoclonal.10. The antibody or fragment thereof of claim 1 , which is chimeric.11. The antibody or fragment thereof of claim 1 , which is humanized.12. The antibody or fragment thereof of claim 1 , which is human.13. The antibody or fragment thereof of claim 1 , which is bispecific.14. The antibody or fragment thereof of claim 1 , which inhibits delivery of type III secretory toxins into target cells.1533.-. (canceled)34. An isolated polynucleotide molecule comprising a polynucleotide that encodes the antibody or fragment thereof of .35. An isolated polynucleotide molecule comprising a polynucleotide which encodes (i) the VH of amino acids 1-124 of SEQ ID NO:264 claim 1 , (ii) the VL of amino acids 1-107 of SEQ ID NO:263 or (iii) both the VH of amino acids 1-124 of SEQ ID NO:264 and the VL of amino ...

Anti-Pseudomonas PSL Binding Molecules and Uses Thereof

This disclosure relates to an anti-Pseudomonas Psl binding molecule and uses thereof, in particular in prevention and treatment of Pseudomonas infection. Furthermore, the disclosure provides compositions and methods for preventing and treating Pseudomonas infection.

ANTIBODIES TO S. AUREUS SURFACE DETERMINANTS

Antibodies and antigen binding fragments thereof directed against () surface determinant antigens and secreted toxins are disclosed. Methods of detecting, diagnosing and treating using the antibodies and antigen binding fragments thereof are also provided. 164-. (canceled)65S. aureusS. aureusS. aureus. A method of treating an infection in a patient , comprising administering an antibody or antigen binding fragment thereof that specifically binds to an alpha toxin (AT) and an antibody or antigen binding fragment thereof that specifically binds to an surface determinant antigen , wherein the antibody or antigen binding fragment thereof that specifically binds AT comprises:a. a heavy chain variable region (VH) complementarity determining region (CDR)1 comprising the amino acid sequence of SEQ ID NO:69;b. a VH CDR2 comprising the amino acid sequence of SEQ ID NO:70;C. a VH CDR3 comprising the amino acid sequence of SEQ ID NO:71;d. a light chain variable region (VL) CDR1 comprising the amino acid sequence of SEQ ID NO:1;e. a VL CDR2 comprising the amino acid sequence of SEQ ID NO:2; andf. a VL CDR3 comprising the amino acid sequence of SEQ ID NO:68.66S. aureusS. aureusS. aureus. A method for preventing or reducing the severity of -associated sepsis in a patient , comprising administering an antibody or antigen binding fragment thereof that specifically binds to an alpha toxin (AT) and an antibody or antigen binding fragment thereof that specifically binds to an surface determinant antigen , wherein the antibody or antigen binding fragment thereof that specifically binds AT comprises:a. a VH CDR1 comprising the amino acid sequence of SEQ ID NO:69;b. a VH CDR2 comprising the amino acid sequence of SEQ ID NO:70;C. a VH CDR3 comprising the amino acid sequence of SEQ ID NO:71;d. a VL CDR1 comprising the amino acid sequence of SEQ ID NO:1;e. a VL CDR2 comprising the amino acid sequence of SEQ ID NO:2; andf. a VL CDR3 comprising the amino acid sequence of SEQ ID NO:68.67S. ...

Anti-pseudomonas psl binding molecules and uses thereof

Combination therapies using anti- pseudomonas psl and pcrv binding molecules

Multispecific and multivalent binding proteins and uses thereof

The disclosure generally provides proteins that bind two epitopes (e.g., a first and a second epitope) and that are bivalent for binding to each of the first and second epitopes. The disclosure also provides compositions comprising such proteins, nucleic acid molecules encoding such proteins and methods of making and using such proteins.

ISOLATED ANTIBODY OR ITS ANTIGEN BINDING FRAGMENT, COMPOSITION UNDERSTANDING THE ANTIBODY ANTIBODY OR FRAGMENT, KIT, USE OF AN EFFECTIVE QUANTITY OF AN ANTIBODY OR ITS ANTIGEN BINDING FRAGMENT AND THE ANTIGEN LAYING METHOD

ANTICORPO ISOLADO OU SEU FRAGMENTO DE LIGAÇÃO A ANTÍGENO, COMPOSIÇÃO COMPREENDENDO O ANTICORPO OU FRAGMENTO DE LIGAÇÃO A ANTÍGENO, KIT, USO DE UMA QUANTIDADE EFICAZ DE UM ANTICORPO OU SEU FRAGMENTO DE LIGAÇÃO A ANTÍGENO, MÉTODO PARA INIBIR A FORMAÇÃO DA OLIGÔMEROS DE ALFA-TOXINA e MÉTODO DE INIBIR A FORMAÇÃO DA OLIGÔMEROS DE ALFA-TOXINA. A presente invenção refere-se a composições, métodos de produção e métodos de utilização pertencendo a anticorpos anti-alfa-toxina e fragmentos. ISOLATED ANTIBODY OR ITS ANTIGEN BINDING FRAGMENT, COMPOSITION UNDERSTANDING THE ANTIGEN ANTIBODY OR FRAGMENT, KIT, USE OF AN EFFECTIVE AMOUNT OF AN ANTIBODY OR ITS ANTIGEN BINDING FRAGMENT, THE METHOD OF HYGIENIC HYGIENIC LOSS and METHOD OF INHIBITING THE FORMATION OF ALPHA-TOXIN OLIGOMERS. The present invention relates to compositions, methods of production and methods of use pertaining to anti-alpha toxin antibodies and fragments.

Anti-pseudomonas psl binding molecules and uses thereof.

La presente invención se refiere a moléculas de unión anti-Ps1 de Pseudomonas y usos de las mismas, en particular en la prevención y el tratamiento de infección por Pseudomonas. Asimismo, la descripción proporciona composiciones y métodos para prevenir y tratar la infección por Pseudomonas.

Antibodies to s. aureus surface determinants

Antibodies and antigen binding fragments thereof directed against Staphylococcus aureus (S. aureus) surface determinant antigens and secreted toxins are disclosed. Methods of detecting, diagnosing and treating S. aureus using the antibodies and antigen binding fragments thereof are also provided.

Methods of treating s. aureus-associated diseases

Antibodies directed against Staphylococcus aureus leukotoxins

The present disclosure is directed to leukotoxin-binding antibodies and antigen-binding fragments thereof. The antibodies and fragments can be used, for example, to detect leukotoxin and/or in methods of treating and preventing Staphylococcus aureus infections.

Combination therapies using anti- pseudomonas psl and pcrv binding molecules

This disclosure relates to combination therapies comprising anti-Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.

Immunogenic compositions of Staphylococcus epidermidis polypeptide and polynucleotide antigens

The present invention relates to immunogenic compositions, comprising polypeptides isolated from Staphylococcus epidermidis. The invention also relates to polynucleotides encoding Staphylococcus epidermidis polypeptides and their use in immunogenic compositions. In addition, the invention relates to methods of inducing an immune response in mammals against Staphylococcus epidermidis and Staphylococcus aureus using immunogenic compositions of the Staphylococcus epidermidis polypeptides and polynucleotides. The invention also relates to methods for detecting Staphylococcus epidermidis in a biological sample.

Combination therapies using anti-Pseudomonas Psl and PcrV binding molecules

Using anti-Pseudomonas PsI and PcrV binding molecules and related compositions in prevention and treatment of Pseudomonas infection are disclosed. Further provided are isolated binding molecules which specifically bind to Pseudomonas PcrV or Pseudomonas PsI, and bispecific antibodies that specifically bind to Pseudomonas PcrV and Pseudomonas PsI. The sequences of heavy chain and light chain as well as sequences of complementarity determining regions (CDRs) of these binding molecules are further disclosed.

Combinations of anti-Staphylococcus aureus antibodies

The present disclosure is directed to anti- Staphylococcus aureus antibody combinations including combinations of antibodies that bind to S. aureus alpha toxin (AT) protein, clumping factor A protein (ClfA), and/or at least one leukotoxin protein. Methods of treating and preventing infections comprising administering the antibody combinations are also provided herein.

Antibodies that specifically bind staphylococcus aureus alpha toxin and methods of use

Anti-pseudomonas psl binding molecules and uses thereof

Abstract This disclosure relates to an anti-Pseudomonas Psl binding molecules and uses thereof, in particular in prevention and treatment of Pseudomonas infection. Furthermore, the disclosure provides compositions and methods for preventing and treating Pseudomonasinfection.

Antibody directed against s. aureus clumping factor a (clfa)

The present disclosure is directed to a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to a Staphylococcus aureus clumping factor A protein (ClfA), as well as compositions comprising the monoclonal antibody. The disclosure also is directed to methods of treating a Staphylococcus aureus infection by administering the anti-ClfA monoclonal antibody alone, or in combination with a monoclonal antibody that specifically binds to S. aureus alpha toxin (AT) protein to a subject. Bispecific monoclonal antibodies that specifically bind to both ClfA and AT and methods of using the same also are provided.

Antibodies that specifically bind staphylococcus aureus alpha toxin and methods of use

The disclosure provides compositions, methods of manufacture and methods of use of antibodies and fragments that bind Staphylococcus aureus alpha toxin. More specifically, the disclosure provides VH CDR and VL CDR region sequences of antibodies or antigen-binding fragments. Method of preventing, treating or managing a condition associated with Staphylococcus aureus infection using the antibodies are also disclosed.

Antibodies to S. aureus surface determinants

Antibodies and antigen binding fragments thereof directed against Staphylococcus aureus (S. aureus) surface determinant antigens and secreted toxins are disclosed. Methods of detecting, diagnosing and treating S. aureus using the antibodies and antigen binding fragments thereof are also provided.

Antibodies directed against staphylococcus aureus leukotoxins

The present disclosure is directed to leukotoxin-binding antibodies and antigen-binding fragments thereof. The antibodies and fragments can be used, for example, to detect leukotoxin and/or in methods of treating and preventing Staphylococcus aureus infections.

Anti-pseudomonas psl binding molecules and uses thereof

Neutralization of tgf-beta or alpha-v-beta-8 integrin for s. aureus infections

The present disclosure is directed to methods of using compounds that neutralize TGF-Beta or Alpha-V-Beta-8 (e.g., anti-TGF-Beta or anti-Alpha-V-Beta-8 antibodies and antigen-binding fragments thereof) for the treatment or prevention of S. aureus infections in patients in need thereof. Such patients include patients with an increased incidence of severe bacterial infections, e.g., diabetic patients.

isolated binding molecule or antigen binding fragment thereof, bispecific antibody, isolated polynucleotide molecule, composition, method for preventing or treating a pseudomonas infection in an individual, and, kit

Anti-pseudomonas psl binding molecules and uses thereof

Antibodies that specifically bind staphylococcus aureus alpha toxin and methods of use

Immunogenic compositions of Staphylococcus epidermidis polypeptide antigens

Combination therapies using anti- pseudomonas psl and pcrv binding molecules.

Terapias de combinación que comprenden moléculas de unión anti-Psl y PcrV de Pseudomonas y composiciones relacionadas, para usar en la prevención y tratamiento de infección por Pseudomonas.

Combination therapies using anti-pseudomonas psl and pcrv binding molecules

Using anti-Pseudomonas PsI and PcrV binding molecules and related compositions in prevention and treatment of Pseudomonas infection are disclosed. Further provided are isolated binding molecules which specifically bind to Pseudomonas PcrV or Pseudomonas PsI, and bispecific antibodies that specifically bind to Pseudomonas PcrV and Pseudomonas PsI. The sequences of heavy chain and light chain as well as sequences of complementarity determining regions (CDRs) of these binding molecules are further disclosed.

Combination therapies using anti-pseudomonas psl and pcrv binding molecules

This disclosure relates to combination therapies comprising anti-Pseudomonas Psl and PcrV binding molecules and related compositions, for use in prevention and treatment of Pseudomonas infection.

Anticuerpos contra determinantes de la superficie de s. aureus.

Se describen anticuerpos y fragmentos de unión al antígeno de estos dirigidos contra determinantes antigénicos de la superficie Staphylococcus aureus (S. aureus) y toxinas secretadas. También se proporcionan métodos para detectar, diagnosticar y tratar S. aureus empleando los anticuerpos y fragmentos de unión al antígeno de éstos.

Anti-pcrv and psl bispecific antibodies for treatment of bronchiectasis

This disclosure relates to anti- Pseudomonas Psl and PcrV bispecific antibodies for use in treatment of bronchiectasis.

Treatment of polybacterials infections

多細菌性感染の治療

【課題】多細菌性感染を予防および治療する方法を提供する。【解決手段】多細菌性感染における細菌の少なくとも１つによって生成されるエピトープに特異的に結合する抗体またはその抗原結合断片を有効量投与するステップを含む、方法である。例えば、黄色ブドウ球菌（Ｓｔａｐｈｙｌｏｃｏｃｃｕｓ ａｕｒｅｕｓ）α毒素に特異的に結合する抗体が、緑膿菌（Ｐｓｅｕｄｏｍｏｎａｓ ａｅｒｕｇｉｎｏｓａ）の成長を阻害するため、黄色ブドウ球菌（Ｓｔａｐｈｙｌｏｃｏｃｃｕｓ ａｕｒｅｕｓ）および緑膿菌（Ｐｓｅｕｄｏｍｏｎａｓ ａｅｒｕｇｉｎｏｓａ）を含む多細菌性感染を有する患者に投与され得る。【選択図】図８

Antibody directed against S. aureus clumping factor A (ClfA)

The present disclosure is directed to a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to a Staphylococcus aureus clumping factor A protein (ClfA), as well as compositions comprising the monoclonal antibody. The disclosure also is directed to methods of treating a Staphylococcus aureus infection by administering the anti-ClfA monoclonal antibody alone, or in combination with a monoclonal antibody that specifically binds to S. aureus alpha toxin (AT) protein to a subject. Bispecific monoclonal antibodies that specifically bind to both ClfA and AT and methods of using the same also are provided.

Θεραπειες συνδυασμου με χρηση μοριων προσδεσης psl και pcrv αντι- pseudomonas

Η αποκάλυψη αυτή αναφέρεται σε θεραπείες συνδυασμού που περιλαμβάνουν μόρια πρόσδεσης Psl και PcrV αντι-Ρseudomonas και σχετικές συνθέσεις, για χρήση στην πρόληψη και θεραπευτική αγωγή λοίμωξης από Pseudomonas.

Treatment of polybacterials infections

Provided herein are methods of preventing and treating polybacterial infections comprising administering an effective amount of an antibody or antigen-binding fragment thereof that specifically binds to an epitope produced by at least one of the bacterium in the polybacterial infection. For example, an antibody that specifically binds to Staphylococcus aureus alpha toxin can be administered to a patient with a polybacterial infection comprising Staphylococcus aureus and Pseudomonas aeruginosa to inhibit the growth of Pseudomonas aeruginosa.

ANTIBODY DIRECTED AGAINST S. AUREUS CLUMPING FACTOR A (ClfA)

The present disclosure is directed to a monoclonal antibody, or antigen-binding fragment thereof, that specifically binds to a Staphylococcus aureus clumping factor A protein (ClfA), as well as compositions comprising the monoclonal antibody. The disclosure also is directed to methods of treating a Staphylococcus aureus infection by administering the anti-ClfA monoclonal antibody alone, or in combination with a monoclonal antibody that specifically binds to S. aureus alpha toxin (AT) protein to a subject. Bispecific monoclonal antibodies that specifically bind to both ClfA and AT and methods of using the same also are provided.

Antibodies that specifically bind Staphylococcus aureus alpha toxin and methods of use

Herein provided are compositions, methods of manufacture and methods of use pertaining to anti-alpha toxin antibodies and fragments.